Recombinant Human G0S2 Protein, GST-tagged

• Cat.No.: G0S2-4603H
• Product Overview: Human G0S2 full-length ORF ( AAH09694.1, 1 a.a. - 103 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: G0S2 (G0/G1 Switch 2) is a Protein Coding gene. Among its related pathways are Regulation of lipid metabolism by Peroxisome proliferator-activated receptor alpha (PPARalpha) and Metabolism.
• Molecular Mass: 37.07 kDa
• AA Sequence: METVQELIPLAKEMMAQKRKGKMVKLYVLGSVLALFGVVLGLMETVCSPFTAARRLRDQEAAVAELQAALERQALQKQALQEKGKQQDTVLGGRALSNRQHAS
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: G0S2 G0/G1switch 2 [ Homo sapiens ]
• Official Symbol: G0S2
• Synonyms: RP1-28O10.2; G0S2; G0/G1switch 2; G0/G1 Switch 2; Putative Lymphocyte G0/G1 Switch Gene 2; G0/G1 Switch Regulatory Protein 2; G0/G1switch 2
• Gene ID: 50486
• mRNA Refseq: NM_015714
• Protein Refseq: NP_056529
• MIM: 614447
• UniProt ID: P27469