Recombinant Full Length Human G0S2 Protein, GST-tagged

Cat.No. : G0S2-5096HF
Product Overview : Human G0S2 full-length ORF ( AAH09694.1, 1 a.a. - 103 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 103 amino acids
Description : G0S2 (G0/G1 Switch 2) is a Protein Coding gene. Among its related pathways are Regulation of lipid metabolism by Peroxisome proliferator-activated receptor alpha (PPARalpha) and Metabolism.
Molecular Mass : 37.07 kDa
AA Sequence : METVQELIPLAKEMMAQKRKGKMVKLYVLGSVLALFGVVLGLMETVCSPFTAARRLRDQEAAVAELQAALERQALQKQALQEKGKQQDTVLGGRALSNRQHAS
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name G0S2 G0/G1switch 2 [ Homo sapiens ]
Official Symbol G0S2
Synonyms RP1-28O10.2; G0S2; G0/G1switch 2; G0/G1 Switch 2; Putative Lymphocyte G0/G1 Switch Gene 2; G0/G1 Switch Regulatory Protein 2; G0/G1switch 2
Gene ID 50486
mRNA Refseq NM_015714
Protein Refseq NP_056529
MIM 614447
UniProt ID P27469

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All G0S2 Products

Required fields are marked with *

My Review for All G0S2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon