Recombinant Human FZD8 Protein, GST-tagged

• Cat.No.: FZD8-4600H
• Product Overview: Human FZD8 partial ORF ( NP_114072, 72 a.a. - 161 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: This intronless gene is a member of the frizzled gene family. Members of this family encode seven-transmembrane domain proteins that are receptors for the Wingless type MMTV integration site family of signaling proteins. Most frizzled receptors are coupled to the beta-catenin canonical signaling pathway. This gene is highly expressed in two human cancer cell lines, indicating that it may play a role in several types of cancer. The crystal structure of the extracellular cysteine-rich domain of a similar mouse protein has been determined. [provided by RefSeq
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 35.64 kDa
• AA Sequence: FWPLVEIQCSPDLKFFLCSMYTPICLEDYKKPLPPCRSVCERAKAGCAPLMRQYGFAWPDRMRCDRLPEQGNPDTLCMDYNRTDLTTAAP
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: FZD8 frizzled family receptor 8 [ Homo sapiens ]
• Official Symbol: FZD8
• Synonyms: FZD8; frizzled family receptor 8; frizzled (Drosophila) homolog 8, frizzled 8, seven transmembrane spanning receptor, frizzled homolog 8 (Drosophila); frizzled-8; frizzled homolog 8; frizzled 8, seven transmembrane spanning receptor; FZ-8; hFZ8
• Gene ID: 8325
• mRNA Refseq: NM_031866
• Protein Refseq: NP_114072
• MIM: 606146
• UniProt ID: Q9H461