Recombinant Human FZD7

• Cat.No.: FZD7-26288TH
• Product Overview: Recombinant fragment of Human Frizzled 7 with a proprietary tag: predicted molecular weight 36.52 kDa.

Specification

• Description: Members of the frizzled gene family encode 7-transmembrane domain proteins that are receptors for Wnt signaling proteins.The FZD7 protein contains an N-terminal signal sequence, 10 cysteine residues typical of the cysteine-rich extracellular domain of Fz family members, 7 putative transmembrane domains, and an intracellular C-terminal tail with a PDZ domain-binding motif.FZD7 gene expression may downregulate APC function and enhance beta-catenin-mediated signals in poorly differentiated human esophageal carcinomas.
• Protein length: 99 amino acids
• Molecular Weight: 36.520kDa inclusive of tags
• Source: Wheat germ
• Tissue specificity: High expression in adult skeletal muscle and fetal kidney, followed by fetal lung, adult heart, brain, and placenta. Specifically expressed in squamous cell esophageal carcinomas.
• Biological activity: This product is useful for Antibody Production and Protein Array
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.79% Tris HCl, 0.31% GlutathioneNote: Glutathione is reduced
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: GAGEICVGQNTSDGSGGPGGGPTAYPTAPYLPDLPFTALPPGASDGRGRPAFPFSCPRQLKVPPYLGYRFLGERDCGAPCEPGRANGLMYFKEEERRFA
• Sequence Similarities: Belongs to the G-protein coupled receptor Fz/Smo family.Contains 1 FZ (frizzled) domain.
• Tag: Non

Gene Information

• Gene Name: FZD7 frizzled family receptor 7 [ Homo sapiens ]
• Official Symbol: FZD7
• Synonyms: FZD7; frizzled family receptor 7; frizzled (Drosophila) homolog 7 , frizzled 7, seven transmembrane spanning receptor , frizzled homolog 7 (Drosophila); frizzled-7; FzE3
• Gene ID: 8324
• mRNA Refseq: NM_003507
• Protein Refseq: NP_003498
• MIM: 603410
• Uniprot ID: O75084
• Chromosome Location: 2q33
• Pathway: Basal cell carcinoma, organism-specific biosystem; Basal cell carcinoma, conserved biosystem; Class B/2 (Secretin family receptors), organism-specific biosystem; GPCR ligand binding, organism-specific biosystem; HTLV-I infection, organism-specific biosystem
• Function: G-protein coupled receptor activity; PDZ domain binding; Wnt-activated receptor activity; Wnt-protein binding; receptor activity