Recombinant Human FZD2 Protein, GST-tagged

• Cat.No.: FZD2-4591H
• Product Overview: Human FZD2 partial ORF ( NP_001457, 192 a.a. - 245 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: Members of the frizzled gene family encode 7-transmembrane domain proteins that are receptors for Wnt signaling proteins. The expression of the FZD2 gene appears to be developmentally regulated, with high levels of expression in fetal kidney and lung and in adult colon and ovary. [provided by RefSeq
• Molecular Mass: 31.68 kDa
• AA Sequence: YATLEHPFHCPRVLKVPSYLSYKFLGERDCAAPCEPARPDGSMFFSQEETRFAR
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: FZD2 frizzled family receptor 2 [ Homo sapiens ]
• Official Symbol: FZD2
• Synonyms: FZD2; frizzled family receptor 2; frizzled (Drosophila) homolog 2, frizzled 2, seven transmembrane spanning receptor, frizzled homolog 2 (Drosophila); frizzled-2; frizzled homolog 2; frizzled 2, seven transmembrane spanning receptor; Fz2; fz-2; fzE2; hFz2
• Gene ID: 2535
• mRNA Refseq: NM_001466
• Protein Refseq: NP_001457
• MIM: 600667
• UniProt ID: Q14332