Recombinant Human FZD10 protein, His-tagged

Cat.No. : FZD10-2184H
Product Overview : Recombinant Human FZD10 protein(NP_009128)(23-229 aa), fused to His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 23-229 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.). 5 % trehalose and 5 % mannitol are added as protectants before lyophilization.
AA Sequence : SMDMERPGDGKCQPIEIPMCKDIGYNMTRMPNLMGHENQREAAIQLHEFAPLVEYGCHGHLRFFLCSLYAPMCTEQVSTPIPACRVMCEQARLKCSPIMEQFNFKWPDSLDCRKLPNKNDPNYLCMEAPNNGSDEPTRGSGLFPPLFRPQRPHSAQEHPLKDGGPGRGGCDNPGKFHHVEKSASCAPLCTPGVDVYWSREDKRFAVV
Purity : 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name FZD10 frizzled family receptor 10 [ Homo sapiens ]
Official Symbol FZD10
Synonyms FZD10; frizzled family receptor 10; frizzled (Drosophila) homolog 10 , frizzled 10, seven transmembrane spanning receptor , frizzled homolog 10 (Drosophila); frizzled-10; CD350; frizzled homolog 10; frizzled 10, seven transmembrane spanning receptor; Fz10; FzE7; FZ-10; hFz10;
Gene ID 11211
mRNA Refseq NM_007197
Protein Refseq NP_009128
MIM 606147
UniProt ID Q9ULW2

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All FZD10 Products

Required fields are marked with *

My Review for All FZD10 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon