Recombinant Human FXR1 protein, His-tagged

Cat.No. : FXR1-544H
Product Overview : Recombinant Human FXR1 protein(P51114)(1-127aa), fused with C-terminal His tag, was expressed in E.coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 1-127aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 15.6 kDa
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
AA Sequence : MAELTVEVRGSNGAFYKGFIKDVHEDSLTVVFENNWQPERQVPFNEVRLPPPPDIKKEISEGDEVEVYSRANDQEPCGWWLAKVRMMKGEFYVIEYAACDATYNEIVTFERLRPVNQNKTVKKNTFF
Gene Name FXR1 fragile X mental retardation, autosomal homolog 1 [ Homo sapiens ]
Official Symbol FXR1
Synonyms FXR1; fragile X mental retardation, autosomal homolog 1; fragile X mental retardation syndrome-related protein 1; hFXR1p; FXR1P;
Gene ID 8087
mRNA Refseq NM_001013438
Protein Refseq NP_001013456
MIM 600819
UniProt ID P51114

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All FXR1 Products

Required fields are marked with *

My Review for All FXR1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon