Recombinant Human FUT5 Protein, GST-tagged

• Cat.No.: FUT5-4564H
• Product Overview: Human FUT5 partial ORF ( NP_002025, 95 a.a. - 164 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: FUT5 (Fucosyltransferase 5) is a Protein Coding gene. Among its related pathways are Metabolism and Glycosphingolipid biosynthesis - lacto and neolacto series. GO annotations related to this gene include fucosyltransferase activity and 3-galactosyl-N-acetylglucosaminide 4-alpha-L-fucosyltransferase activity. An important paralog of this gene is FUT3.
• Molecular Mass: 33.44 kDa
• AA Sequence: SEMVPGAADCNITADSSVYPQADAVIVHHWDIMYNPSANLPPPTRPQGQRWIWFSMESPSNCRHLEALDG
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: FUT5 fucosyltransferase 5 (alpha (1,3) fucosyltransferase) [ Homo sapiens ]
• Official Symbol: FUT5
• Synonyms: FUT5; fucosyltransferase 5 (alpha (1,3) fucosyltransferase); alpha-(1,3)-fucosyltransferase; FUC TV; fucT-V; fucosyltransferase V; alpha (1,3) fucosyltransferase; galactoside 3-L-fucosyltransferase; FUC-TV
• Gene ID: 2527
• mRNA Refseq: NM_002034
• Protein Refseq: NP_002025
• MIM: 136835
• UniProt ID: Q11128