Recombinant Human FUT10 Protein, GST-tagged

• Cat.No.: FUT10-4558H
• Product Overview: Human FUT10 full-length ORF ( AAH04884, 1 a.a. - 92 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: FUT10 (Fucosyltransferase 10) is a Protein Coding gene. GO annotations related to this gene include fucosyltransferase activity and alpha-(1->3)-fucosyltransferase activity. An important paralog of this gene is FUT11.
• Molecular Mass: 35.86 kDa
• AA Sequence: MEEAPTHLNSFLKKEGLTFNRKRKWELDSYPIMLWWSPLTGETGRLGQCGADACFFTINRTYLHHHMTKAFLFYGKQDFRLSPLFAVVFLQS
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: FUT10 fucosyltransferase 10 (alpha (1,3) fucosyltransferase) [ Homo sapiens ]
• Official Symbol: FUT10
• Synonyms: FUT10; fucosyltransferase 10 (alpha (1,3) fucosyltransferase); alpha-(1,3)-fucosyltransferase 10; fuc-TX; fucT-X; fucosyltransferase X; alpha 1,3-fucosyl transferase; galactoside 3-L-fucosyltransferase 10; MGC11141
• Gene ID: 84750
• mRNA Refseq: NM_032664
• Protein Refseq: NP_116053
• MIM: 616931
• UniProt ID: Q6P4F1