Recombinant human full length VDAC1, GST-tagged
Cat.No. : | VDAC1-21H |
Product Overview : | Recombinant human full length VDAC1(1 a.a. - 283 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ. |
Availability | April 21, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a voltage-dependent anion channel protein that is a major component of the outer mitochondrial membrane. The encoded protein facilitates the exchange of metabolites and ions across the outer mitochondrial membrane and may regulate mitochondrial functions. This protein also forms channels in the plasma membrane and may be involved in transmembrane electron transport. Alternate splicing results in multiple transcript variants. Multiple pseudogenes of this gene are found on chromosomes 1, 2 3, 6, 9, 12, X and Y. |
Molecular Mass : | 57.20 kDa |
AA Sequence : | MAVPPTYADLGKSARDVFTKGYGFGLIKLDLKTKSENGLEFTSSGSANTETTKVTGSLETKYRWTEYGLTFTEKW NTDNTLGTEITVEDQLARGLKLTFDSSFSPNTGKKNAKIKTGYKREHINLGCDMDFDIAGPSIRGALVLGYEGWL AGYQMNFETAKSRVTQSNFAVGYKTDEFQLHTNVNDGTEFGGSIYQKVNKKLETAVNLAWTAGNSNTRFGIAAKY QIDPDACFSAKVNNSSLIGLGYTQTLKPGIKLTLSALLDGKNVNAGGHKLGLGLEFQA |
Applications : | ELISA; WB-Re; AP; Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80ºC. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Full Length : | Full L. |
Gene Name | VDAC1 voltage-dependent anion channel 1 [ Homo sapiens (human) ] |
Official Symbol | VDAC1 |
Synonyms | VDAC1; voltage-dependent anion channel 1; PORIN; VDAC-1; voltage-dependent anion-selective channel protein 1; porin 31HL; porin 31HM; plasmalemmal porin; outer mitochondrial membrane protein porin 1 |
Gene ID | 7416 |
mRNA Refseq | NM_003374 |
Protein Refseq | NP_003365 |
MIM | 604492 |
UniProt ID | P21796 |
Chromosome Location | 5q31 |
Pathway | Calcium signaling pathway; HTLV-I infection; Huntington's disease; Metabolism of proteins |
Function | porin activity; protein kinase binding; voltage-gated anion channel activity |
◆ Recombinant Proteins | ||
VDAC1-16H | Recombinant Human Voltage-Dependent Anion Channel-1 | +Inquiry |
VDAC1-5865H | Recombinant Human VDAC1 protein, GST-tagged | +Inquiry |
VDAC1-3268C | Recombinant Chicken VDAC1 | +Inquiry |
VDAC1-18000M | Recombinant Mouse VDAC1 Protein | +Inquiry |
VDAC1-6552H | Recombinant Human VDAC1 Protein (Met1-Ala283), N-His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
VDAC1-732HCL | Recombinant Human VDAC1 lysate, Flag-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All VDAC1 Products
Required fields are marked with *
My Review for All VDAC1 Products
Required fields are marked with *
0
Inquiry Basket