Recombinant Human Full length S100A7 protein(1-101 aa), C-His-tagged

• Cat.No.: S100A7-2884H
• Product Overview: Recombinant Human Full length S100A7 protein(P31151)(1-101 aa), fused with C-terminal His tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: His
• Protein length: 1-101 aa
• Form: 0.15 M Phosphate buffered saline
• AASequence: MSNTQAERSIIGMIDMFHKYTRRDDKIEKPSLLTMMKENFPNFLSACDKKGTNYLADVFEKKDKNEDKKIDFSEFLSLLGDIATDYHKQSHGAAPCSGGSQ
• Storage: Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
  Up to 12 months when aliquoted and stored at -20 to -80°C.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.

Gene Information

• Gene Name: S100A7 S100 calcium binding protein A7 [ Homo sapiens ]
• Official Symbol: S100A7
• Synonyms: S100A7; S100 calcium binding protein A7; PSOR1, S100 calcium binding protein A7 (psoriasin 1) , S100 calcium binding protein A7 (psoriasin 1); protein S100-A7; S100A7c; psoriasin 1; S100 calcium-binding protein A7 (psoriasin 1); PSOR1
• Gene ID: 6278
• mRNA Refseq: NM_002963
• Protein Refseq: NP_002954
• MIM: 600353
• UniProt ID: P31151