Recombinant Human FTSJ2 Protein, GST-tagged

• Cat.No.: FTSJ2-4538H
• Product Overview: Human FTSJ2 partial ORF ( NP_037525, 1 a.a. - 103 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: The protein encoded by this gene is a member of the S-adenosylmethionine-binding protein family. It is a nucleolar protein and it may be involved in the processing and modification of rRNA. This gene has been suggested to be involved in cell cycle control and DNA repair. [provided by RefSeq
• Molecular Mass: 37.07 kDa
• AA Sequence: MAGYLKLVCVSFQRQGFHTVGSRCKNRTGAEHLWLTRHLRDPFVKAAKVESYRCRSAFKLLEVNERHQILRPGLRVLDCGAAPGAWSQVAVQKVNAAGTDPSS
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: FTSJ2 FtsJ homolog 2 (E. coli) [ Homo sapiens ]
• Official Symbol: FTSJ2
• Synonyms: FTSJ2; FtsJ homolog 2 (E. coli); putative ribosomal RNA methyltransferase 2; cell division protein FtsJ; FJH1; rRNA (uridine 2 O ) methyltransferase; protein ftsJ homolog 2; rRNA (uridine-2-O-)-methyltransferase; DKFZp686J14194
• Gene ID: 29960
• mRNA Refseq: NM_013393
• Protein Refseq: NP_037525
• MIM: 606906
• UniProt ID: Q9UI43