Description :	The protein encoded by this gene is a member of the S-adenosylmethionine-binding protein family. It is a nucleolar protein and may be involved in the processing and modification of rRNA. Three alternatively spliced transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq
Source :	Wheat Germ
Species :	Human
Tag :	GST
Molecular Mass :	61.93 kDa
AA Sequence :	MGRTSKDKRDVYYRLAKENGWRARSAFKLLQLDKEFQLFQGVTRAVDLCAAPGSWSQVLSQKIGGQGSGHVVAVDLQAMAPLPGVVQIQGDITQLSTAKEIIQHFKGCPADLVVCDGAPDVTDLHDVDEYMQAQLLLAALNIATHVLKPGGCFVAKIFRGRDVTLLYSQLQVFFSSVLCAKPRSSRNSSIEAFAVCQGYDPPEGFIPDLSKPLLDHSYDPDFNQLDGPTRIIVPFVTCGDLSSYDSDRSYPLDLEGGSEYKYTPPTQPPISPPYQEACTLKRKGQLAKEIRPQDCPISRVDTFPQPLAAPQCHTLLAPEMEDNEMSCSP
Applications :	Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array
Notes :	Best use within three months from the date of receipt of this protein.
Storage :	Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer :	50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Name	FTSJ1 FtsJ homolog 1 (E. coli) [ Homo sapiens ]
Official Symbol	FTSJ1
Synonyms	FTSJ1; FtsJ homolog 1 (E. coli); mental retardation, X linked 9, mental retardation, X linked 44, MRX9, MRX44; putative ribosomal RNA methyltransferase 1; CDLIV; JM23; SPB1; TRM7; cell division protein; protein ftsJ homolog 1; rRNA (uridine-2-O-)-methyltransferase; MRX9; MRX44;
Gene ID	24140
mRNA Refseq	NM_012280
Protein Refseq	NP_036412
MIM	300499
UniProt ID	Q9UET6