Recombinant Human FSTL1 protein(176-285aa), His-GST-tagged

Cat.No. : FSTL1-2065H
Product Overview : Recombinant Human FSTL1 protein(Q12841)(176-285aa), fused with N-terminal His and GST tag, was expressed in E.coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST&His
Protein Length : 176-285aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 43.8 kDa
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
AA Sequence : ETAINITTYPDQENNKLLRGLCVDALIELSDENADWKLSFQEFLKCLNPSFNPPEKKCALEDETYADGAETEVDCNRCVCACGNWVCTAMTCDGKNQKGAQTQTEEEMTR
Gene Name FSTL1 follistatin-like 1 [ Homo sapiens ]
Official Symbol FSTL1
Synonyms FSTL1; follistatin-like 1; follistatin-related protein 1; FRP; FSL1; follistatin-like protein 1; FLJ50214; FLJ52277;
Gene ID 11167
mRNA Refseq NM_007085
Protein Refseq NP_009016
MIM 605547
UniProt ID Q12841

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All FSTL1 Products

Required fields are marked with *

My Review for All FSTL1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon