Recombinant Human FSTL1 protein(176-285aa), His-GST-tagged

• Cat.No.: FSTL1-2065H
• Product Overview: Recombinant Human FSTL1 protein(Q12841)(176-285aa), fused with N-terminal His and GST tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: N-His-GST
• ProteinLength: 176-285aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 43.8 kDa
• AASequence: ETAINITTYPDQENNKLLRGLCVDALIELSDENADWKLSFQEFLKCLNPSFNPPEKKCALEDETYADGAETEVDCNRCVCACGNWVCTAMTCDGKNQKGAQTQTEEEMTR
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.

Gene Information

• Gene Name: FSTL1 follistatin-like 1 [ Homo sapiens ]
• Official Symbol: FSTL1
• Synonyms: FSTL1; follistatin-like 1; follistatin-related protein 1; FRP; FSL1; follistatin-like protein 1; FLJ50214; FLJ52277
• Gene ID: 11167
• mRNA Refseq: NM_007085
• Protein Refseq: NP_009016
• MIM: 605547
• UniProt ID: Q12841