Recombinant Human FSHR Protein, His-tagged

Cat.No. : FSHR-23H
Product Overview : Recombinant human FSHR (Cys18-Pro113) protein with His tag was expressed in E.coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 18-113 a.a.
Description : The protein encoded by this gene belongs to family 1 of G-protein coupled receptors. It is the receptor for follicle stimulating hormone and functions in gonad development. Mutations in this gene cause ovarian dysgenesis type 1, and also ovarian hyperstimulation syndrome. Alternative splicing results in multiple transcript variants.
Form : Freeze-dried powder
Molecular Mass : 12.6kDa
AA Sequence : CHHRICHCSNRVFLCQESKVTEIPSDLPRNAIELRFVLTKLRVIQKGAFSGFGDLEKIEISQNDVLEVIEADVFSNLPKLHEIRIEKANNLLYINP
Endotoxin : <1.0 EU per 1 μg (determined by the LAL method)
Purity : > 95%
Applications : Positive Control; Immunogen; SDS-PAGE; WB.
If bio-activity of the protein is needed, please check active protein.
Usage : Reconstitute in PBS or others.
Stability : The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37 centigrade for 48h, and no obvious degradation and precipitation were observed. The loss rate is less than 5% within the expiration date under appropriate storage condition.
Storage : Avoid repeated freeze/thaw cycles. Store at 2-8 centigrade for one month. Aliquot and store at -80 centigrade for 12 months.
Storage Buffer : PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
Gene Name FSHR follicle stimulating hormone receptor [ Homo sapiens (human) ]
Official Symbol FSHR
Synonyms FSHR; follicle stimulating hormone receptor; LGR1; ODG1; FSHR1; FSHRO; follicle-stimulating hormone receptor; FSH receptor; follitropin receptor
Gene ID 2492
mRNA Refseq NM_000145
Protein Refseq NP_000136
MIM 136435
UniProt ID P23945

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All FSHR Products

Required fields are marked with *

My Review for All FSHR Products

Required fields are marked with *

0

Inquiry Basket

cartIcon