Recombinant Human FSHR Protein, GST-tagged

• Cat.No.: FSHR-4522H
• Product Overview: Human FSHR partial ORF ( NP_000136, 18 a.a. - 120 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: The protein encoded by this gene belongs to family 1 of G-protein coupled receptors. It is the receptor for follicle stimulating hormone and functions in gonad development. Alternative splicing occurs at this locus and two transcript variants encoding distinct isoforms have been identified. [provided by RefSeq
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 37.07 kDa
• AA Sequence: CHHRICHCSNRVFLCQESKVTEIPSDLPRNAIELRFVLTKLRVIQKGAFSGFGDLEKIEISQNDVLEVIEADVFSNLPKLHEIRIEKANNLLYINPEAFQNLP
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: FSHR follicle stimulating hormone receptor [ Homo sapiens ]
• Official Symbol: FSHR
• Synonyms: FSHR; follicle stimulating hormone receptor; ODG1; follicle-stimulating hormone receptor; FSHRO; LGR1; FSH receptor; follitropin receptor; MGC141667; MGC141668
• Gene ID: 2492
• mRNA Refseq: NM_000145
• Protein Refseq: NP_000136
• MIM: 136435
• UniProt ID: P23945