Recombinant Human FRRS1L Protein, GST-tagged

• Cat.No.: FRRS1L-5151H
• Product Overview: Human C9orf4 partial ORF ( NP_055149, 158 a.a. - 267 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes a component of the outer-core of an alpha-amino-3-hydroxy-5-methyl-4-isoxazolepropionic acid (AMPA) receptor protein in the brain. The encoded protein is thought to interact with inner-core components of the receptor, and play a role in the modulation of glutamate signaling. Mutations in this gene are associated with early infantile epileptic encephalopathy 37. [provided by RefSeq, Jul 2016]
• Molecular Mass: 37.84 kDa
• AA Sequence: FRYGKPGCNAETCDYFLSYRMIGADVEFELSADTDGWVAVGFSSDKKMGGDDVMACVHDDNGRVRIQHFYNVGQWAKEIQRNPARDEEGVFENNRVTCRFKRPVNVPRDE
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: FRRS1L ferric chelate reductase 1 like [ Homo sapiens (human) ]
• Official Symbol: FRRS1L
• Synonyms: C9orf4; FRRS1L; ferric chelate reductase 1 like; CG6; CG-6; C9orf4; EIEE37; DOMON domain-containing protein FRRS1L; brain protein CG-6
• Gene ID: 23732
• mRNA Refseq: NM_014334
• Protein Refseq: NP_055149
• MIM: 604574
• UniProt ID: Q9P0K9