Recombinant Human FRMD8 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | FRMD8-2522H |
Product Overview : | FRMD8 MS Standard C13 and N15-labeled recombinant protein (NP_114110) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | Promotes the cell surface stability of iRhom1/RHBDF1 and iRhom2/RHBDF2 and prevents their degradation via the endolysosomal pathway. By acting on iRhoms, involved in ADAM17-mediated shedding of TNF, amphiregulin/AREG, HBEGF and TGFA from the cell surface. Negatively regulates Wnt signaling, possibly by antagonizing the recruitment of AXIN1 to LRP6. |
Molecular Mass : | 51.2 kDa |
AA Sequence : | MDGTEGSAGQPGPAERSHRSSVSSVGARAADVLVYLADDTVVPLAVENLPSLSAHELHRAVREVLQLPDIALDVFALWLVSPLLEVQLKPKHQPYKLGRQWPELLLRFTSAPDDDVAMDEPFLQFRRNVFFPKRRELQIHDEEVLRLLYEEAKGNVLAARYPCDVEDCEALGALVCRVQLGPYQPGRPAACDLREKLDSFLPAHLCKRGQSLFAALRGRGARAGPGEQGLLNAYRQVQEVSSDGGCEAALGTHYRAYLLKCHELPFYGCAFFHGEVDKPAQGFLHRGGRKPVSVAISLEGVHVIDSREKHVLLGLRFQELSWDHTSPEEEEPILWLEFDGDSEGTPVNKLLKIYSKQAELMSSLIEYCIELSQAAEPAGPQDSATGSPSDPSSSLAPVQRPKLRRQGSVVSSRIQHLSTIDYVEDGKGIRRVKPKRTTSFFSRQLSLGQGSYTVVQPGDSLEQGTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | FRMD8 FERM domain containing 8 [ Homo sapiens (human) ] |
Official Symbol | FRMD8 |
Synonyms | FRMD8; FERM domain containing 8; FERM domain-containing protein 8; FKSG44; FLJ90369; FLJ32216; MGC31785; |
Gene ID | 83786 |
mRNA Refseq | NM_031904 |
Protein Refseq | NP_114110 |
MIM | 618337 |
UniProt ID | Q9BZ67 |
◆ Recombinant Proteins | ||
FRMD8-2522H | Recombinant Human FRMD8 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
FRMD8-3363M | Recombinant Mouse FRMD8 Protein, His (Fc)-Avi-tagged | +Inquiry |
FRMD8-1574R | Recombinant Rhesus Macaque FRMD8 Protein, His (Fc)-Avi-tagged | +Inquiry |
FRMD8-2049R | Recombinant Rat FRMD8 Protein, His (Fc)-Avi-tagged | +Inquiry |
FRMD8-6043M | Recombinant Mouse FRMD8 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
FRMD8-6136HCL | Recombinant Human FRMD8 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FRMD8 Products
Required fields are marked with *
My Review for All FRMD8 Products
Required fields are marked with *
0
Inquiry Basket