Recombinant Human FRMD8 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: FRMD8-2522H
• Product Overview: FRMD8 MS Standard C13 and N15-labeled recombinant protein (NP_114110) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Description: Promotes the cell surface stability of iRhom1/RHBDF1 and iRhom2/RHBDF2 and prevents their degradation via the endolysosomal pathway. By acting on iRhoms, involved in ADAM17-mediated shedding of TNF, amphiregulin/AREG, HBEGF and TGFA from the cell surface. Negatively regulates Wnt signaling, possibly by antagonizing the recruitment of AXIN1 to LRP6.
• Source: HEK293
• Species: Human
• Tag: Myc&DDK
• Molecular Mass: 51.2 kDa
• AA Sequence: MDGTEGSAGQPGPAERSHRSSVSSVGARAADVLVYLADDTVVPLAVENLPSLSAHELHRAVREVLQLPDIALDVFALWLVSPLLEVQLKPKHQPYKLGRQWPELLLRFTSAPDDDVAMDEPFLQFRRNVFFPKRRELQIHDEEVLRLLYEEAKGNVLAARYPCDVEDCEALGALVCRVQLGPYQPGRPAACDLREKLDSFLPAHLCKRGQSLFAALRGRGARAGPGEQGLLNAYRQVQEVSSDGGCEAALGTHYRAYLLKCHELPFYGCAFFHGEVDKPAQGFLHRGGRKPVSVAISLEGVHVIDSREKHVLLGLRFQELSWDHTSPEEEEPILWLEFDGDSEGTPVNKLLKIYSKQAELMSSLIEYCIELSQAAEPAGPQDSATGSPSDPSSSLAPVQRPKLRRQGSVVSSRIQHLSTIDYVEDGKGIRRVKPKRTTSFFSRQLSLGQGSYTVVQPGDSLEQGTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: FRMD8 FERM domain containing 8 [ Homo sapiens (human) ]
• Official Symbol: FRMD8
• Synonyms: FRMD8; FERM domain containing 8; FERM domain-containing protein 8; FKSG44; FLJ90369; FLJ32216; MGC31785
• Gene ID: 83786
• mRNA Refseq: NM_031904
• Protein Refseq: NP_114110
• MIM: 618337
• UniProt ID: Q9BZ67