Recombinant Human FPR2 Protein, GST-tagged
Cat.No. : | FPR2-4487H |
Product Overview : | Human FPR2 partial ORF ( AAH29125.1, 163 a.a. - 205 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | FPR2 (Formyl Peptide Receptor 2) is a Protein Coding gene. Diseases associated with FPR2 include Prion Disease. Among its related pathways are Peptide ligand-binding receptors and Immune response CCR3 signaling in eosinophils. GO annotations related to this gene include G-protein coupled receptor activity and N-formyl peptide receptor activity. An important paralog of this gene is FPR3. |
Molecular Mass : | 30.36 kDa |
AA Sequence : | FLTTVTIPNGDTYCTFNFASWGGTPEERLKVAITMLTARGIIR |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | FPR2 formyl peptide receptor 2 [ Homo sapiens ] |
Official Symbol | FPR2 |
Synonyms | FPR2; formyl peptide receptor 2; formyl peptide receptor like 1, FPRL1; N-formyl peptide receptor 2; ALXR; FMLP R II; FMLPX; FPR2A; FPRH2; HM63; LXA4R; RFP; FMLP-R-I; LXA4 receptor; FMLP-related receptor I; formyl peptide receptor-like 1; lipoxin A4 receptor (formyl peptide receptor related); FPRH1; FPRL1; FMLP-R-II; |
Gene ID | 2358 |
mRNA Refseq | NM_001005738 |
Protein Refseq | NP_001005738 |
MIM | 136538 |
UniProt ID | P25090 |
◆ Recombinant Proteins | ||
FPR2-12996H | Recombinant Human FPR2, His-tagged | +Inquiry |
RFL2428GF | Recombinant Full Length Gorilla Gorilla Gorilla N-Formyl Peptide Receptor 2(Fpr2) Protein, His-Tagged | +Inquiry |
FPR2-1039HFL | Recombinant Human FPR2 protein, His&Flag-tagged | +Inquiry |
RFL10443PF | Recombinant Full Length Pan Troglodytes N-Formyl Peptide Receptor 2(Fpr2) Protein, His-Tagged | +Inquiry |
FPR2-6023M | Recombinant Mouse FPR2 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
FPR2-665HCL | Recombinant Human FPR2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FPR2 Products
Required fields are marked with *
My Review for All FPR2 Products
Required fields are marked with *
0
Inquiry Basket