Description :	FPR2 (Formyl Peptide Receptor 2) is a Protein Coding gene. Diseases associated with FPR2 include Prion Disease. Among its related pathways are Peptide ligand-binding receptors and Immune response CCR3 signaling in eosinophils. GO annotations related to this gene include G-protein coupled receptor activity and N-formyl peptide receptor activity. An important paralog of this gene is FPR3.
Source :	Wheat Germ
Species :	Human
Tag :	GST
Molecular Mass :	30.36 kDa
AA Sequence :	FLTTVTIPNGDTYCTFNFASWGGTPEERLKVAITMLTARGIIR
Applications :	Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array
Notes :	Best use within three months from the date of receipt of this protein.
Storage :	Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer :	50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Name	FPR2 formyl peptide receptor 2 [ Homo sapiens ]
Official Symbol	FPR2
Synonyms	FPR2; formyl peptide receptor 2; formyl peptide receptor like 1, FPRL1; N-formyl peptide receptor 2; ALXR; FMLP R II; FMLPX; FPR2A; FPRH2; HM63; LXA4R; RFP; FMLP-R-I; LXA4 receptor; FMLP-related receptor I; formyl peptide receptor-like 1; lipoxin A4 receptor (formyl peptide receptor related); FPRH1; FPRL1; FMLP-R-II;
Gene ID	2358
mRNA Refseq	NM_001005738
Protein Refseq	NP_001005738
MIM	136538
UniProt ID	P25090