Recombinant Human FOXQ1 Protein, GST-tagged

• Cat.No.: FOXQ1-4477H
• Product Overview: Human FOXQ1 partial ORF ( NP_150285, 110 a.a. - 219 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: FOXQ1 is a member of the FOX gene family, which is characterized by a conserved 110-amino acid DNA-binding motif called the forkhead or winged helix domain. FOX genes are involved in embryonic development, cell cycle regulation, tissue-specific gene expression, cell signaling, and tumorigenesis (Bieller et al., 2001 [PubMed 11747606]).[supplied by OMIM
• Molecular Mass: 37.84 kDa
• AA Sequence: RSKPYTRRPKPPYSYIALIAMAIRDSAGGRLTLAEINEYLMGKFPFFRGSYTGWRNSVRHNLSLNDCFVKVLRDPSRPWGKDNYWMLNPNSEYTFADGVFRRRRKRLSHR
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: FOXQ1 forkhead box Q1 [ Homo sapiens ]
• Official Symbol: FOXQ1
• Synonyms: FOXQ1; forkhead box Q1; forkhead box protein Q1; HFH1; HFH-1; HNF-3/forkhead-like protein 1; winged helix/forkhead transcription factor; hepatocyte nuclear factor 3 forkhead homolog 1
• Gene ID: 94234
• mRNA Refseq: NM_033260
• Protein Refseq: NP_150285
• MIM: 612788
• UniProt ID: Q9C009