Recombinant Human FOXO1, His-tagged
Cat.No. : | FOXO1-28946TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 277-655 of Human FOXO1A with N terminal His tag; 379 amino acids, 49kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 277-655 a.a. |
Description : | This gene belongs to the forkhead family of transcription factors which are characterized by a distinct forkhead domain.The specific function of this gene has not yet been determined; however, it may play a role in myogenic growth and differentiation. Translocation of this gene with PAX3 has been associated with alveolar rhabdomyosarcoma. |
Conjugation : | HIS |
Tissue specificity : | Ubiquitous. |
Form : | Lyophilised:Reconstitute with 151 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | LQSGQEGAGDSPGSQFSKWPASPGSHSNDDFDNWSTFRPR TSSNASTISGRLSPIMTEQDDLGEGDVHSMVYPPSAAK MASTLPSLSEISNPENMENLLDNLNLLSSPTSLTVSTQSS PGTMMQQTPCYSFAPPNTSLNSPSPNYQKYTYGQSSMS PLPQMPIQTLQDNKSSYGGMSQYNCAPGLLKELLTSDS PPHNDIMTPVDPGVAQPNSRVLGQNVMMGPNSVMSTYGSQ ASHNKMMNPSSHTHPGHAQQTSAVNGRPLPHTVSTMPH TSGMNRLTQVKTPVQVPLPHPMQMSALGGYSSVSSCNG YGRMGLLHQEKLPSDLDGMFIERLDCDMESIIRNDLMDGD TLDFNFDNVLPNQSFPHSVKTTTHSWVSG |
Sequence Similarities : | Contains 1 fork-head DNA-binding domain. |
Gene Name | FOXO1 forkhead box O1 [ Homo sapiens ] |
Official Symbol | FOXO1 |
Synonyms | FOXO1; forkhead box O1; FKHR, forkhead homolog in rhabdomyosarcoma , FOXO1A; forkhead box protein O1; FKH1; |
Gene ID | 2308 |
mRNA Refseq | NM_002015 |
Protein Refseq | NP_002006 |
MIM | 136533 |
Uniprot ID | Q12778 |
Chromosome Location | 13q14.1 |
Pathway | AKT phosphorylates targets in the nucleus, organism-specific biosystem; AKT-mediated inactivation of FOXO1A, organism-specific biosystem; Adipogenesis, organism-specific biosystem; Angiopoietin receptor Tie2-mediated signaling, organism-specific biosystem; B Cell Receptor Signaling Pathway, organism-specific biosystem; |
Function | DNA bending activity; double-stranded DNA binding; protein binding; protein kinase binding; sequence-specific DNA binding; |
◆ Recombinant Proteins | ||
FOXO1-28946TH | Recombinant Human FOXO1, His-tagged | +Inquiry |
FOXO1-3151HFL | Recombinant Full Length Human FOXO1 protein, Flag-tagged | +Inquiry |
FOXO1-6006M | Recombinant Mouse FOXO1 Protein | +Inquiry |
FOXO1-3028H | Recombinant Human FOXO1 Protein (Ser301-Gly655), N-His tagged | +Inquiry |
FOXO1-2387R | Recombinant Rat FOXO1 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
FOXO1-6149HCL | Recombinant Human FOXO1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FOXO1 Products
Required fields are marked with *
My Review for All FOXO1 Products
Required fields are marked with *
0
Inquiry Basket