Recombinant Human FOXK2

• Cat.No.: FOXK2-29031TH
• Product Overview: Recombinant fragment of Human ILF1 with N terminal proprietary tag, predicted MWt 36.63 kDa.

Specification

• Description: The protein encoded by this gene contains a fork head DNA binding domain. This protein can bind to the purine-rich motifs of the HIV long terminal repeat (LTR), and to the similar purine-rich motif in the interleukin 2 (IL2) promoter. It may be involved in the regulation of viral and cellular promoter elements.
• Protein length: 100 amino acids
• Molecular Weight: 36.630kDa inclusive of tags
• Source: Wheat germ
• Tissue specificity: Expressed in both lymphoid and non-lymphoid cells.
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: QQAPLGQHQLPIKTVTQNGTHVASVPTAVHGQVNNAAASPLHMLATHASASASLPTKRHNGDQPEQPELKRIKTEDGEGIVIALSVDTPPAAVREKGVQN
• Sequence Similarities: Contains 1 FHA domain.Contains 1 fork-head DNA-binding domain.
• Tag: Non

Gene Information

• Gene Name: FOXK2 forkhead box K2 [ Homo sapiens ]
• Official Symbol: FOXK2
• Synonyms: FOXK2; forkhead box K2; ILF, ILF1, interleukin enhancer binding factor 1; forkhead box protein K2
• Gene ID: 3607
• mRNA Refseq: NM_004514
• Protein Refseq: NP_004505
• MIM: 147685
• Uniprot ID: Q01167
• Chromosome Location: 17q25
• Function: DNA bending activity; double-stranded DNA binding; magnesium ion binding; sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity