Recombinant Human FOSL1 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: FOSL1-5606H
• Product Overview: FOSL1 MS Standard C13 and N15-labeled recombinant protein (NP_005429) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Description: The Fos gene family consists of 4 members: FOS, FOSB, FOSL1, and FOSL2. These genes encode leucine zipper proteins that can dimerize with proteins of the JUN family, thereby forming the transcription factor complex AP-1. As such, the FOS proteins have been implicated as regulators of cell proliferation, differentiation, and transformation. Several transcript variants encoding different isoforms have been found for this gene.
• Source: HEK293
• Species: Human
• Tag: Myc&DDK
• Molecular Mass: 29.4 kDa
• AA Sequence: MFRDFGEPGPSSGNGGGYGGPAQPPAAAQAAQQKFHLVPSINTMSGSQELQWMVQPHFLGPSSYPRPLTYPQYSPPQPRPGVIRALGPPPGVRRRPCEQISPEEEERRRVRRERNKLAAAKCRNRRKELTDFLQAETDKLEDEKSGLQREIEELQKQKERLELVLEAHRPICKIPEGAKEGDTGSTSGTSSPPAPCRPVPCISLSPGPVLEPEALHTPTLMTTPSLTPFTPSLVFTYPSTPEPCASAHRKSSSSSGDPSSDPLGSPTLLALTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: FOSL1 FOS-like antigen 1 [ Homo sapiens (human) ]
• Official Symbol: FOSL1
• Synonyms: FOSL1; FOS-like antigen 1; fos-related antigen 1; fra 1; FOS-like antigen-1; FRA; FRA1; fra-1
• Gene ID: 8061
• mRNA Refseq: NM_005438
• Protein Refseq: NP_005429
• MIM: 136515
• UniProt ID: P15407