Recombinant Human FOLR3 Protein, GST-tagged

• Cat.No.: FOLR3-4422H
• Product Overview: Human FOLR3 full-length ORF ( AAI48786.1, 1 a.a. - 245 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: This gene encodes a member of the folate receptor (FOLR) family, members of which have a high affinity for folic acid and for several reduced folic acid derivatives, and mediate delivery of 5-methyltetrahydrofolate to the interior of cells. This gene includes two polymorphic variants; the shorter one has two base deletion in the CDS, resulting in a truncated polypeptide, compared to the longer one. Both protein products are constitutively secreted in hematopoietic tissues and are potential serum marker for certain hematopoietic malignancies. The longer protein has a 71% and 79% sequence homology with the FOLR1 and FOLR2 proteins, respectively. [provided by RefSeq
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 53.9 kDa
• AA Sequence: MDMAWQMMQLLLLALVTAAGSAQPRSARARTDLLNVCMNAKHHKTQPSPEDELYGQCSPWKKNACCTASTSQELHKDTSRLYNFNWDHCGKMEPTCKRHFIQDSCLYECSPNLGPWIRQVNQSWRKERILNVPLCKEDCERWWEDCRTSYTCKSNWHKGWNWTSGINECPAGALCSTFESYFPTPAALCEGLWSHSFKVSNYSRGSGRCIQMWFDSAQGNPNEEVAKFYAAAMNAGAPSRGIIDS
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: FOLR3 folate receptor 3 (gamma) [ Homo sapiens ]
• Official Symbol: FOLR3
• Synonyms: FOLR3; folate receptor 3 (gamma); folate receptor gamma; FR G; FR-G; FR-gamma; gamma-hFR
• Gene ID: 2352
• mRNA Refseq: NM_000804
• Protein Refseq: NP_000795
• MIM: 602469
• UniProt ID: P41439