Recombinant Human FOLR3 Protein, GST-tagged
Cat.No. : | FOLR3-4422H |
Product Overview : | Human FOLR3 full-length ORF ( AAI48786.1, 1 a.a. - 245 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a member of the folate receptor (FOLR) family, members of which have a high affinity for folic acid and for several reduced folic acid derivatives, and mediate delivery of 5-methyltetrahydrofolate to the interior of cells. This gene includes two polymorphic variants; the shorter one has two base deletion in the CDS, resulting in a truncated polypeptide, compared to the longer one. Both protein products are constitutively secreted in hematopoietic tissues and are potential serum marker for certain hematopoietic malignancies. The longer protein has a 71% and 79% sequence homology with the FOLR1 and FOLR2 proteins, respectively. [provided by RefSeq |
Molecular Mass : | 53.9 kDa |
AA Sequence : | MDMAWQMMQLLLLALVTAAGSAQPRSARARTDLLNVCMNAKHHKTQPSPEDELYGQCSPWKKNACCTASTSQELHKDTSRLYNFNWDHCGKMEPTCKRHFIQDSCLYECSPNLGPWIRQVNQSWRKERILNVPLCKEDCERWWEDCRTSYTCKSNWHKGWNWTSGINECPAGALCSTFESYFPTPAALCEGLWSHSFKVSNYSRGSGRCIQMWFDSAQGNPNEEVAKFYAAAMNAGAPSRGIIDS |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | FOLR3 folate receptor 3 (gamma) [ Homo sapiens ] |
Official Symbol | FOLR3 |
Synonyms | FOLR3; folate receptor 3 (gamma); folate receptor gamma; FR G; FR-G; FR-gamma; gamma-hFR; |
Gene ID | 2352 |
mRNA Refseq | NM_000804 |
Protein Refseq | NP_000795 |
MIM | 602469 |
UniProt ID | P41439 |
◆ Recombinant Proteins | ||
FOLR3-4422H | Recombinant Human FOLR3 Protein, GST-tagged | +Inquiry |
FOLR3-5037HF | Recombinant Full Length Human FOLR3 Protein, GST-tagged | +Inquiry |
FOLR3-557H | Active Recombinant Human Folate Receptor 3 (Gamma), His-tagged | +Inquiry |
FOLR3-2962H | Recombinant Human FOLR3 Protein, His (Fc)-Avi-tagged | +Inquiry |
FOLR3-2204H | Active Recombinant Human FOLR3 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FOLR3-6169HCL | Recombinant Human FOLR3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FOLR3 Products
Required fields are marked with *
My Review for All FOLR3 Products
Required fields are marked with *
0
Inquiry Basket