Recombinant Human FOLR2 Protein, His-tagged
Cat.No. : | FOLR2-254H |
Product Overview : | Recombinant human FOLR2 protein with His tag was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Protein Length : | 255 |
Description : | The protein encoded by this gene is a member of the folate receptor (FOLR) family, and these genes exist in a cluster on chromosome 11. Members of this gene family have a high affinity for folic acid and for several reduced folic acid derivatives, and they mediate delivery of 5-methyltetrahydrofolate to the interior of cells. This protein has a 68% and 79% sequence homology with the FOLR1 and FOLR3 proteins, respectively. Although this protein was originally thought to be specific to placenta, it can also exist in other tissues, and it may play a role in the transport of methotrexate in synovial macrophages in rheumatoid arthritis patients. Multiple transcript variants that encode the same protein have been found for this gene. |
Form : | Lyophilized |
Molecular Mass : | 26 kDa |
AA Sequence : | MVWKWMPLLLLLVCVATMCSAQDRTDLLNVCMDAKHHKTKPGPEDKLHDQCSPWKKNACCTASTSQELHKDTSRLYNFNWDHCGKMEPACKRHFIQDTCLYECSPNLGPWIQQVNQSWRKERFLDVPLCKEDCQRWWEDCHTSHTCKSNWHRGWDWTSGVNKCPAGALCRTFESYFPTPAALCEGLWSHSYKVSNYSRGSGRCIQMWFDSAQGNPNEEVARFYAAAMHVNAGEMLHGTGGLLLSLALMLQLWLLG |
Purity : | > 98% |
Applications : | WB; ELISA; FACS; FC |
Stability : | This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use. |
Storage : | At -20 centigrade. |
Concentration : | 1 mg/mL |
Storage Buffer : | PBS (pH 7.4-7.5). Sterile-filtered colorless solution. |
Reconstitution : | Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance. |
Gene Name | FOLR2 folate receptor 2 (fetal) [ Homo sapiens (human) ] |
Official Symbol | FOLR2 |
Synonyms | FOLR2; folate receptor 2 (fetal); folate receptor beta; FBP; folate receptor, beta; folate receptor, fetal/placental; placental folate-binding protein; folate-binding protein, fetal/placental; FR-P3; FR-BETA; BETA-HFR; FBP/PL-1; |
Gene ID | 2350 |
mRNA Refseq | NM_000803 |
Protein Refseq | NP_000794 |
MIM | 136425 |
UniProt ID | P14207 |
◆ Recombinant Proteins | ||
FOLR2-1559R | Recombinant Rhesus Macaque FOLR2 Protein, His (Fc)-Avi-tagged | +Inquiry |
FOLR2-28943TH | Recombinant Human FOLR2 | +Inquiry |
FOLR2-254H | Recombinant Human FOLR2 Protein, His-tagged | +Inquiry |
FOLR2-005H | Active Recombinant Human FOLR2 Protein, His-tagged | +Inquiry |
FOLR2-2815H | Recombinant Human FOLR2 Protein (19-230 aa), His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FOLR2-2541HCL | Recombinant Human FOLR2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FOLR2 Products
Required fields are marked with *
My Review for All FOLR2 Products
Required fields are marked with *
0
Inquiry Basket