Recombinant Human FNBP1L Protein, GST-tagged

• Cat.No.: FNBP1L-4405H
• Product Overview: Human FNBP1L partial ORF ( NP_060207.2, 175 a.a. - 239 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: The protein encoded by this gene binds to both CDC42 and N-WASP. This protein promotes CDC42-induced actin polymerization by activating the N-WASP-WIP complex and, therefore, is involved in a pathway that links cell surface signals to the actin cytoskeleton. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 32.89 kDa
• AA Sequence: LNLRTHMADENKNEYAAQLQNFNGEQHKHFYVVIPQIYKQLQEMDERRTIKLSECYRGFADSERK
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: FNBP1L formin binding protein 1-like [ Homo sapiens ]
• Official Symbol: FNBP1L
• Synonyms: FNBP1L; formin binding protein 1-like; TOCA1; C1orf39; Formin Binding Protein 1 Like; Transducer Of Cdc42-Dependent Actin Assembly Protein 1; C1orf39; Toca-1; TOCA1; Transducer Of Cdc42-Dependent Actin Assembly 1; Chromosome 1 Open Reading Frame 39; Formin Binding Protein 1-Like; Formin-Binding Protein 1-Like
• Gene ID: 54874
• mRNA Refseq: NM_017737
• Protein Refseq: NP_060207
• MIM: 608848
• UniProt ID: Q5T0N5