Recombinant Human FN1 protein, T7/His-tagged

Cat.No. : FN1-183H
Product Overview : Recombinant FN-III EDB domain of Human fibronectin cDNA fused with T7-His-TEV cleavage site Tag at N-terminal was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&T7
Form : 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol.
AA Sequence : MASMTGGQQMGRGHHHHHHGNLYFQGGEFNVSVYTVKDDKESVPISDTIIPEVPQLTDLSFVDITDSSIGLRWTP LNSSTIIGYRITVVAAGEGIPIFEDFVDSSVGYYTVTGLEPGIDYDISVITLINGGESAPTTLTQQTAVPPPTDL RFTNIGPDTMRVT
Purity : >90% by SDS-PAGE
Applications : 1. May be used for in vitro FN-III EDB domain mediated human endothelial cell or cancer stroma cell differentiation / migration regulations study with this protein as either soluble factor or coating matrix protein.2. May be used for in vitro protein-protein interaction mapping.3. As antigen for specific antibody production.
Storage : Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days.
Gene Name FN1 fibronectin 1 [ Homo sapiens ]
Official Symbol FN1
Synonyms FN1; fibronectin 1; fibronectin; CIG; cold insoluble globulin; FINC; GFND2; LETS; migration stimulating factor; MSF; cold-insoluble globulin; migration-stimulating factor; FN; FNZ; ED-B; GFND; DKFZp686H0342; DKFZp686I1370; DKFZp686F10164; DKFZp686O13149;
Gene ID 2335
mRNA Refseq NM_002026
Protein Refseq NP_002017
MIM 135600
UniProt ID P02751
Chromosome Location 2q34
Pathway Amoebiasis, organism-specific biosystem; Amoebiasis, conserved biosystem; Angiopoietin receptor Tie2-mediated signaling, organism-specific biosystem; Bacterial invasion of epithelial cells, organism-specific biosystem; Bacterial invasion of epithelial cells, conserved biosystem; Cell surface interactions at the vascular wall, organism-specific biosystem; ECM-receptor interaction, organism-specific biosystem;
Function collagen binding; extracellular matrix structural constituent; heparin binding; protein binding;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All FN1 Products

Required fields are marked with *

My Review for All FN1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon