Recombinant Human FN1 protein, T7/His-tagged

• Cat.No.: FN1-38H
• Product Overview: Recombinant eleventh FN-III domain of Human fibronectin cDNA fused with T7-His-TEV cleavage site Tag (29aa) at N-terminal was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: His&T7
• Form: 1.0 mg/ml, sterile-filtered, in PBS.
• AA Sequence: MASMTGGQQMGRGHHHHHHGNLYFQGGEFEIDKPSQMQVTDVQDNSISVKWLPSSSPVTGYRVTTTPKNGPGPTK TKTAGPDQTEMTIEGLQPTVEYVVSVYAQNPSGESQPLVQTAVT
• Purity: >90% by SDS-PAGE
• Applications: 1. May be used for in vitro human ES lineage specific differentiation regulations study coating with this protein.2. May be used for in vitro protein-protein interaction mapping.3. As antigen for specific antibody production.
• Storage: Keep at -80centigrade for long term storage. Product is stable at 4 centigrade for at least 15 days.

Gene Information

• Gene Name: FN1 fibronectin 1 [ Homo sapiens ]
• Official Symbol: FN1
• Synonyms: FN1; fibronectin 1; fibronectin; CIG; cold insoluble globulin; FINC; GFND2; LETS; migration stimulating factor; MSF; cold-insoluble globulin; migration-stimulating factor; FN; FNZ; ED-B; GFND; DKFZp686H0342; DKFZp686I1370; DKFZp686F10164; DKFZp686O13149
• Gene ID: 2335
• mRNA Refseq: NM_002026
• Protein Refseq: NP_002017
• MIM: 135600
• UniProt ID: P02751
• Chromosome Location: 2q34
• Pathway: Amoebiasis, organism-specific biosystem; Amoebiasis, conserved biosystem; Angiopoietin receptor Tie2-mediated signaling, organism-specific biosystem; Bacterial invasion of epithelial cells, organism-specific biosystem; Bacterial invasion of epithelial cells, conserved biosystem; Cell surface interactions at the vascular wall, organism-specific biosystem; ECM-receptor interaction, organism-specific biosystem
• Function: collagen binding; extracellular matrix structural constituent; heparin binding; protein binding