Recombinant Human FN1 protein, GST-tagged
Cat.No. : | FN1-1811H |
Product Overview : | Recombinant Human FN1 protein(2177-2386 aa), fused to GST tag, was expressed in E. coli. |
Availability | April 20, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 2177-2386 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH. |
AA Sequence : | DQQRHKVREEVVTVGNSVNEGLNQPTDDSCFDPYTVSHYAVGDEWERMSESGFKLLCQCLGFGSGHFRCDSSRWCHDNGVNYKIGEKWDRQGENGQMMSCTCLGNGKGEFKCDPHEATCYDDGKTYHVGEQWQKEYLGAICSCTCFGGQRGWRCDNCRRPGGEPSPEGTTGQSYNQYSQRYHQRTNTNVNCPIECFMPLDVQADREDSRE |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | FN1 fibronectin 1 [ Homo sapiens ] |
Official Symbol | FN1 |
Synonyms | FN1; fibronectin 1; fibronectin; CIG; cold insoluble globulin; FINC; GFND2; LETS; migration stimulating factor; MSF; cold-insoluble globulin; migration-stimulating factor; FN; FNZ; ED-B; GFND; DKFZp686H0342; DKFZp686I1370; DKFZp686F10164; DKFZp686O13149; |
Gene ID | 2335 |
mRNA Refseq | NM_002026 |
Protein Refseq | NP_002017 |
MIM | 135600 |
UniProt ID | P02751 |
◆ Recombinant Proteins | ||
FN1-882H | Active Recombinant Human FN1 Protein, His-tagged | +Inquiry |
FN1-41H | Recombinant Human FN1 protein, T7/His-tagged | +Inquiry |
FN1-10H | Active Recombinant Human Fibronectin Protein, 1358aa-2301aa, C-His tagged | +Inquiry |
FN1-420H | Recombinant Human FN1 Protein | +Inquiry |
FN1-4400H | Recombinant Human FN1 Protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
FN1-2708HB | Native Human Fibronectin Protein, Biotinylated | +Inquiry |
FN1-701H | Native Human Fibronectin 1 | +Inquiry |
Fn1-5424M | Native Mouse Fibronectin | +Inquiry |
FN1-4399H | Native Human FN1 Protein | +Inquiry |
FN1-700H | Native Human Fibronectin 1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
FN1-2956HCL | Recombinant Human FN1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FN1 Products
Required fields are marked with *
My Review for All FN1 Products
Required fields are marked with *
0
Inquiry Basket