Recombinant Human FMO1, GST-tagged

• Cat.No.: FMO1-119H

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Protein Length: 1-532 a.a.
• ProductOverview: Recombinant Human FMO1(1 aa. - 532 aa), fused with aN-terminal GST tag, was expressed in Wheat germ.
• Description: Metabolic N-oxidation of the diet-derived amino-trimethylamine (TMA) is mediated by flavin-containing monooxygenase and is subject to an inherited FMO3 polymorphism in man resulting in a small subpopulation with reduced TMA N-oxidation capacity resulting in fish odor syndrome Trimethylaminuria. Three forms of the enzyme, FMO1 found in fetal liver, FMO2 found in adult liver, and FMO3 are encoded by genes clustered in the 1q23-q25 region. Flavin-containing monooxygenases are NADPH-dependent flavoenzymes that catalyzes the oxidation of soft nucleophilic heteroatom centers in drugs, pesticides, and xenobiotics.
• MolecularMass: 84.26kDa
• AA Sequence: MAKRVAIVGAGVSGLASIKCCLEEGLEPTCFERSDDLGGLWRFTEHVEEGRASLYKSVVSNSCKEMSCYSDFPFPEDYPNYVPNSQFLEYLKMYANHFDLLKHIQFKTKVCSVTKCSDSAVSGQWEVVTMHEEKQESAIFDAVMVCTGFLTNPYLPLDSFPGINAFKGQYFHSRQYKHPDIFKDKRVLVIGMGNSGTDIAVEASHLAEKVFLSTTGGGWVISRIFDSGYPWDMVFMTRFQNMLRNSLPTPIVTWLMERKINNWLNHANYGLIPEDRTQLKEFVLNDELPGRIITGKVFIRPSIKEVKENSVIFNNTSKEEPIDIIVFATGYTFAFPFLDESVVKVEDGQASLYKYIFPAHLQKPTLAIIGLIKPLGSMIPTGETQARWAVRVLKGVNKLPPPSVMIEEINARKENKPSWFGLCYCKALQSDYITYIDELLTYINAKPNLFSMLLTDPHLALTVFFGPCSPYQFRLTGPGKWEGARNAIMTQWDRTFKVIKARVVQESPSPFESFLKVFSFLALLVAIFLIFL
• StorageBuffer: 50 mMTris-HCI, 10 mM reduced Glutathione, pH8.0 in the elution buffer.
• Storage: Store at -80°C. Aliquot to avoid repeated freezing and thawing.

Gene Information

• Gene Name: FMO1 flavin containing monooxygenase 1 [ Homo sapiens ]
• Official Symbol: FMO1
• Synonyms: flavin containing monooxygenase 1; FMO1; dimethylanilinemonooxygenase [N-oxide-forming] 1; FMO 1; OTTHUMP00000033537; dimethylaniline oxidase 1; Flavin-containing monooxygenase 1 (fetal liver); fetal hepatic flavin-containing monooxygenase 1; Dimethylaniline oxidase 1; Fetal hepatic flavin-containing monooxygenase 1; EC 1.14.13.8
• Gene ID: 2326
• mRNA Refseq: NM_002021
• Protein Refseq: NP_002012
• MIM: 136130
• UniProt ID: Q01740
• Chromosome Location: 1q23-q25
• Pathway: Drug metabolism - cytochrome P450; Biological oxidations
• Function: FAD binding; NADP or NADPH binding; binding; flavin-containing monooxygenase activity; monooxygenase activity