Recombinant Human FLT3 Protein, GST-tagged

• Cat.No.: FLT3-4371H
• Product Overview: Human FLT3 partial ORF ( NP_004110, 91 a.a. - 190 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes a class III receptor tyrosine kinase that regulates hematopoiesis. The receptor consists of an extracellular domain composed of five immunoglobulin-like domains, one transmembrane region, and a cytoplasmic kinase domain split into two parts by a kinase-insert domain. The receptor is activated by binding of the fms-related tyrosine kinase 3 ligand to the extracellular domain, which induces homodimer formation in the plasma membrane leading to autophosphorylation of the receptor. The activated receptor kinase subsequently phosphorylates and activates multiple cytoplasmic effector molecules in pathways involved in apoptosis, proliferation, and differentiation of hematopoietic cells in bone marrow. Mutations that result in the constitutive activation of this receptor result in acute myeloid leukemia and acute lymphoblastic leukemia. [provided by RefSeq
• Molecular Mass: 36.63 kDa
• AA Sequence: LQVLVDAPGNISCLWVFKHSSLNCQPHFDLQNRGVVSMVILKMTETQAGEYLLFIQSEATNYTILFTVSIRNTLLYTLRRPYFRKMENQDALVCISESVP
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: FLT3 fms-related tyrosine kinase 3 [ Homo sapiens ]
• Official Symbol: FLT3
• Synonyms: FLT3; fms-related tyrosine kinase 3; receptor-type tyrosine-protein kinase FLT3; CD135; FLK2; STK1; STK-1; CD135 antigen; FL cytokine receptor; fetal liver kinase 2; fms-like tyrosine kinase 3; stem cell tyrosine kinase 1; growth factor receptor tyrosine kinase type III; FLK-2
• Gene ID: 2322
• mRNA Refseq: NM_004119
• Protein Refseq: NP_004110
• MIM: 136351
• UniProt ID: P36888