Recombinant Human FLT1 Protein, His-tagged

Cat.No. : FLT1-24H
Product Overview : Recombinant Human FLT1 Protein, fused to His-tag, was expressed in HEK293.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : His
Description : This gene encodes a member of the vascular endothelial growth factor receptor (VEGFR) family. VEGFR family members are receptor tyrosine kinases (RTKs) which contain an extracellular ligand-binding region with seven immunoglobulin (Ig)-like domains, a transmembrane segment, and a tyrosine kinase (TK) domain within the cytoplasmic domain. This protein binds to VEGFR-A, VEGFR-B and placental growth factor and plays an important role in angiogenesis and vasculogenesis. Expression of this receptor is found in vascular endothelial cells, placental trophoblast cells and peripheral blood monocytes. Multiple transcript variants encoding different isoforms have been found for this gene. Isoforms include a full-length transmembrane receptor isoform and shortened, soluble isoforms. The soluble isoforms are associated with the onset of pre-eclampsia.
Form : Lyophilized from PBS pH7.4, 5% Trehalose, 5% mannitol.
Molecular Mass : 35.56 kDa
AA Sequence : SKLKDPELSLKGTQHIMQAGQTLHLQCRGEAAHKWSLPEMVSKESERLSITKSACGRNGKQFCSTLTLNTAQANHTGFYSCKYLAVPTSKKKETESAIYIFISDTGRPFVEMYSEIPEIIHMTEGRELVIPCRVTSPNITVTLKKFPLDTLIPDGKRIIWDSRKGFIISNATYKEIGLLTCEATVNGHLYKTNYLTHRQTNTIIDVQISTPRPVKLLRGHTLVLNCTATTPLNTRVQMTWSYPDEKNKRASVRRRIDQSNSHANIFYSVLTIDKMQNKDKGLYTCRVR SGPSFKSVNTSVHIAHHHHHHHHHH
Endotoxin : <1EU/ug by LAL.
Purity : >97%
Storage : Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Gene Name FLT1 fms related receptor tyrosine kinase 1 [ Homo sapiens (human) ]
Official Symbol FLT1
Synonyms FLT; FLT-1; VEGFR1; VEGFR-1
Gene ID 2321
mRNA Refseq NM_002019.
Protein Refseq NP_002010
MIM 165070
UniProt ID P17948

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All FLT1 Products

Required fields are marked with *

My Review for All FLT1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon