Recombinant Human FLOT2 Protein, GST-tagged
Cat.No. : | FLOT2-4362H |
Product Overview : | Human FLOT2 full-length ORF ( AAH17292, 1 a.a. - 379 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | Caveolae are small domains on the inner cell membrane involved in vesicular trafficking and signal transduction. This gene encodes a caveolae-associated, integral membrane protein, which is thought to function in neuronal signaling. [provided by RefSeq |
Molecular Mass : | 67.43 kDa |
AA Sequence : | MTLQPRCEDVETAEGVALTVTGVAQVKIMTEKELLAVACEQFLGKNVQDIKNVVLQTLEGHLRSILGTLTVEQIYQDRDQFAKLVREVAAPDVGRMGIEILSFTIKDVYDKVDYLSSLGKTQTAVVQRDADIGVAEAERDAGIREAECKKEMLDVKFMADTKIADSKRAFELQKSAFSEEVNIKTAEAQLAYELQGAREQQKIRQEEIEIEVVQRKKQIAVEAQEILRTDKELIATVRRPAEAEAHRIQQIAEGEKVKQVLLAQAEAEKIRKIGEAEAAVIEAMGKAEAERMKLKAEAYQKYGDAAKMALVLEALPQIAAKIAAPLTKVDEIVVLSGDNSKVTSEVNRLLAELPASVHALTGVDLSKIPLIKKATGVQV |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | FLOT2 flotillin 2 [ Homo sapiens ] |
Official Symbol | FLOT2 |
Synonyms | FLOT2; flotillin 2; M17S1; flotillin-2; ECS 1; ECS1; ESA; ESA1; Flotillin 2 (epidermal surface antigen 1); membrane component; chromosome 17; surface marker 1 (35kD protein identified by monoclonal ECS 1); epidermal surface antigen; membrane component chromosome 17 surface marker 1; membrane component, chromosome 17, surface marker 1 (35kD protein identified by monoclonal ECS-1); ECS-1; |
Gene ID | 2319 |
mRNA Refseq | NM_004475 |
Protein Refseq | NP_004466 |
MIM | 131560 |
UniProt ID | Q14254 |
◆ Recombinant Proteins | ||
FLOT2-921H | Recombinant Human FLOT2 Protein, His (Fc)-Avi-tagged | +Inquiry |
FLOT2-4362H | Recombinant Human FLOT2 Protein, GST-tagged | +Inquiry |
FLOT2-3281M | Recombinant Mouse FLOT2 Protein, His (Fc)-Avi-tagged | +Inquiry |
FLOT2-357H | Recombinant Human FLOT2 protein, His/MBP-tagged | +Inquiry |
FLOT2-2018R | Recombinant Rat FLOT2 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FLOT2-6185HCL | Recombinant Human FLOT2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FLOT2 Products
Required fields are marked with *
My Review for All FLOT2 Products
Required fields are marked with *
0
Inquiry Basket