Recombinant Human FLOT2 Protein, GST-tagged

• Cat.No.: FLOT2-4362H
• Product Overview: Human FLOT2 full-length ORF ( AAH17292, 1 a.a. - 379 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: Caveolae are small domains on the inner cell membrane involved in vesicular trafficking and signal transduction. This gene encodes a caveolae-associated, integral membrane protein, which is thought to function in neuronal signaling. [provided by RefSeq
• Molecular Mass: 67.43 kDa
• AA Sequence: MTLQPRCEDVETAEGVALTVTGVAQVKIMTEKELLAVACEQFLGKNVQDIKNVVLQTLEGHLRSILGTLTVEQIYQDRDQFAKLVREVAAPDVGRMGIEILSFTIKDVYDKVDYLSSLGKTQTAVVQRDADIGVAEAERDAGIREAECKKEMLDVKFMADTKIADSKRAFELQKSAFSEEVNIKTAEAQLAYELQGAREQQKIRQEEIEIEVVQRKKQIAVEAQEILRTDKELIATVRRPAEAEAHRIQQIAEGEKVKQVLLAQAEAEKIRKIGEAEAAVIEAMGKAEAERMKLKAEAYQKYGDAAKMALVLEALPQIAAKIAAPLTKVDEIVVLSGDNSKVTSEVNRLLAELPASVHALTGVDLSKIPLIKKATGVQV
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: FLOT2 flotillin 2 [ Homo sapiens ]
• Official Symbol: FLOT2
• Synonyms: FLOT2; flotillin 2; M17S1; flotillin-2; ECS 1; ECS1; ESA; ESA1; Flotillin 2 (epidermal surface antigen 1); membrane component; chromosome 17; surface marker 1 (35kD protein identified by monoclonal ECS 1); epidermal surface antigen; membrane component chromosome 17 surface marker 1; membrane component, chromosome 17, surface marker 1 (35kD protein identified by monoclonal ECS-1); ECS-1
• Gene ID: 2319
• mRNA Refseq: NM_004475
• Protein Refseq: NP_004466
• MIM: 131560
• UniProt ID: Q14254