Recombinant Human FLNC Protein, GST-tagged

Cat.No. : FLNC-4359H
Product Overview : Human FLNC partial ORF ( NP_001449.3, 2606 a.a. - 2705 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes one of three related filamin genes, specifically gamma filamin. These filamin proteins crosslink actin filaments into orthogonal networks in cortical cytoplasm and participate in the anchoring of membrane proteins for the actin cytoskeleton. Three functional domains exist in filamin: an N-terminal filamentous actin-binding domain, a C-terminal self-association domain, and a membrane glycoprotein-binding domain. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
Molecular Mass : 36.63 kDa
AA Sequence : SSIPKFSSDASKVVTRGPGLSQAFVGQKNSFTVDCSKAGTNMMMVGVHGPKTPCEEVYVKHMGNRVYNVTYTVKEKGDYILIVKWGDESVPGSPFKVKVP
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name FLNC filamin C, gamma [ Homo sapiens ]
Official Symbol FLNC
Synonyms FLNC; filamin C, gamma; filamin C, gamma (actin binding protein 280), FLN2; filamin-C; ABP 280; ABPL; actin binding protein 280; FLN-C; filamin 2; filamin-2; ABP-280-like protein; ABP-L, gamma filamin; actin-binding-like protein; ABPA; FLN2; MFM5; MPD4; ABP-280; ABP280A; FLJ10186;
Gene ID 2318
mRNA Refseq NM_001127487
Protein Refseq NP_001120959
MIM 102565
UniProt ID Q14315

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All FLNC Products

Required fields are marked with *

My Review for All FLNC Products

Required fields are marked with *

0

Inquiry Basket

cartIcon