Recombinant Human FLII protein, His&Myc-tagged
Cat.No. : | FLII-7644H |
Product Overview : | Recombinant Human FLII protein(Q13045)(495-827aa), fused with N-terminal His tag and C-terminal Myc tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&Myc |
Protein Length : | 495-827a.a. |
Tag : | His&Myc |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 44.6 kDa |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | VGQLPGLTIWQIENFVPVLVEEAFHGKFYEADCYIVLKTFLDDSGSLNWEIYYWIGGEATLDKKACSAIHAVNLRNYLGAECRTVREEMGDESEEFLQVFDNDISYIEGGTASGFYTVEDTHYVTRMYRVYGKKNIKLEPVPLKGTSLDPRFVFLLDRGLDIYVWRGAQATLSSTTKARLFAEKINKNERKGKAEITLLVQGQELPEFWEALGGEPSEIKKHVPEDFWPPQPKLYKVGLGLGYLELPQINYKLSVEHKQRPKVELMPRMRLLQSLLDTRCVYILDCWSDVFIWLGRKSPRLVRAAALKLGQELCGMLHRPRHATVSRSLEGTEAAAEQKLISEEDL |
Gene Name | FLII flightless I homolog (Drosophila) [ Homo sapiens ] |
Official Symbol | FLII |
Synonyms | FLII; flightless I homolog (Drosophila); flightless I (Drosophila) homolog; protein flightless-1 homolog; FLI; Fli1; FLIL; MGC39265; |
Gene ID | 2314 |
mRNA Refseq | NM_001256264 |
Protein Refseq | NP_001243193 |
MIM | 600362 |
UniProt ID | Q13045 |
◆ Recombinant Proteins | ||
FLII-3278M | Recombinant Mouse FLII Protein, His (Fc)-Avi-tagged | +Inquiry |
FLII-1163B | Recombinant Bacillus subtilis FLII protein, His-tagged | +Inquiry |
FLII-2243M | Recombinant Mouse FLII Protein (495-827 aa), His-B2M-tagged | +Inquiry |
FLII-2342C | Recombinant Chicken FLII | +Inquiry |
FLII-5920M | Recombinant Mouse FLII Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FLII Products
Required fields are marked with *
My Review for All FLII Products
Required fields are marked with *
0
Inquiry Basket