Recombinant Human FKBP9 Protein, GST-tagged

• Cat.No.: FKBP9-4199H
• Product Overview: Human FKBP9 full-length ORF (BAG54697.1, 1 a.a. - 570 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: FKBP9 (FK506 Binding Protein 9) is a Protein Coding gene. Among its related pathways are Chaperonin-mediated protein folding and Metabolism of proteins. GO annotations related to this gene include calcium ion binding and FK506 binding. An important paralog of this gene is FKBP10.
• Molecular Mass: 89.5 kDa
• AA Sequence: MAFRGWRPPPPQLLLLLLWVTGQAAPVAGLGSDAELQIERRFVPDECPRTVRSGDFVRYHYVGTFPDGQKFDSSYDRDSTFNVFVGKGQLITGMDQALVGMCVNERRFVKIPPKLAYGNEGVSGVIPPNSVLHFDVLLMDIWNSEDQVQIHTYFKPPSCPRTIQVSDFVRYHYNGTFLDGTLFDSSHNRMKTYDTYVGIGWLIPGMDKGLLGMCVGEKRIITIPPFLAYGEDGDGKDIPGQASLVFDVALLDLHNPKDSISIENKVVPENCERISQSGDFLRYHYNGTLLDGTLFDSSYSRNRTFDTYIGQGYVIPGMDEGLLGVCIGEKRRIVVPPHLGYGEEGRGNIPGSAVLVFDIHVIDFHNPSDSISITSHYKPPDCSVLSKKGDYLKYHYNASLLDGTLLDSTWNLGKTYNIVLGSGQVVLGMDMGLREMCVGEKRTVIIPPHLGYGEAGVDGEVPGSAVLVFDIELLELVAGLPEGYMFIWNGEVSPNLFEEIDKDGNGEVLLEEFSEYIHAQVASGKGKLAPGFDAELIVKNMFTNQDRNGDGKVTAEEFKLKDQEAKHDEL
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: FKBP9 FK506 binding protein 9, 63 kDa [ Homo sapiens ]
• Official Symbol: FKBP9
• Synonyms: FKBP9; FK506 binding protein 9, 63 kDa; FK506 binding protein 9 (63 kD); peptidyl-prolyl cis-trans isomerase FKBP9; FKBP60; FKBP63; FKBP-9; FKBP-63; rotamase; 63 kDa FKBP; PPIase FKBP9; FK506-binding protein 9; 63 kDa FK506-binding protein; PPIase; MGC126772; MGC138258; DKFZp586B1723
• Gene ID: 11328
• mRNA Refseq: NM_007270
• Protein Refseq: NP_009201
• MIM: 616257
• UniProt ID: O95302