Recombinant Human FIGF protein, GST-tagged

• Cat.No.: FIGF-301286H
• Product Overview: Recombinant Human FIGF (90-182 aa) protein, fused to GST tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: GST
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• Protein length: Ala90-Thr182
• AA Sequence: AATFYDIETLKVIDEEWQRTQCSPRETCVEVASELGKST
• Purity: 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Stability: Store for up to 12 months at -20°C to -80°C as lyophilized powder.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.

Gene Information

• Gene Name: FIGF c-fos induced growth factor (vascular endothelial growth factor D) [ Homo sapiens ]
• Official Symbol: FIGF
• Synonyms: FIGF; c-fos induced growth factor (vascular endothelial growth factor D); VEGFD; vascular endothelial growth factor D; VEGF D; VEGF-D
• Gene ID: 2277
• mRNA Refseq: NM_004469
• Protein Refseq: NP_004460
• MIM: 300091
• UniProt ID: O43915