Recombinant Human fibroblast growth factor 2 (basic) Protein, HA tagged

Cat.No. : FGF2-57H
Product Overview : Recombinant Human FGF2 Protein with HA tag was expressed in Yeast (animal free media and environment).
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Yeast
Tag : HA
Description : The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members bind heparin and possess broad mitogenic and angiogenic activities. This protein has been implicated in diverse biological processes, such as limb and nervous system development, wound healing, and tumor growth. The mRNA for this gene contains multiple polyadenylation sites, and is alternatively translated from non-AUG (CUG) and AUG initiation codons, resulting in five different isoforms with distinct properties. The CUG-initiated isoforms are localized in the nucleus and are responsible for the intracrine effect, whereas, the AUG-initiated form is mostly cytosolic and is responsible for the paracrine and autocrine effects of this FGF.
Tag : N-HA
Form : Lyophilized
Molecular Mass : 18.2 kDa
AA Sequence : YPYDVPDYAAAGSITTLPALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS
Endotoxin : < 0.2 EU/μg of protein as determined by the LAL method.
Purity : 0.98
Storage : Stable for at least one year at -20 centigrade. Upon reconstitution FGF2 can be stored at +4 centigrade for 2 weeks or at -20 centigrade for 6 months.
Concentration : 120 μg/μL
Storage Buffer : 20mM potassium phosphate, pH 7.0
Reconstitution : Spin the vial briefly, add distilled sterile water.
Gene Name FGF2 fibroblast growth factor 2 (basic) [Homo sapiens (human)]
Official Symbol FGF2
Synonyms FGF2; fibroblast growth factor 2 (basic); FGFB; fibroblast growth factor 2; prostatropin; heparin-binding growth factor 2; basic fibroblast growth factor bFGF; BFGF; FGF-2; HBGF-2
Gene ID 2247
mRNA Refseq NM_002006
Protein Refseq NP_001997
MIM 134920
UniProt ID P09038

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All FGF2 Products

Required fields are marked with *

My Review for All FGF2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon