Active Recombinant Human FGF2 Protein (Formulation I- Carrier Free-Ready-to-Use, 134-288, 154 amino acid)

• Cat.No.: FGF2-23H
• Product Overview: Recombinant Human FGF2 Protein (Formulation I- Carrier Free-Ready-to-Use, 134-288, 154 amino acid) without tag was expressed in E. coli.

Specification

• Description: The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members bind heparin and possess broad mitogenic and angiogenic activities. This protein has been implicated in diverse biological processes, such as limb and nervous system development, wound healing, and tumor growth. The mRNA for this gene contains multiple polyadenylation sites, and is alternatively translated from non-AUG (CUG) and AUG initiation codons, resulting in five different isoforms with distinct properties. The CUG-initiated isoforms are localized in the nucleus and are responsible for the intracrine effect, whereas, the AUG-initiated form is mostly cytosolic and is responsible for the paracrine and autocrine effects of this FGF.
• Source: E. coli
• Species: Human
• Bio-activity: ED50= 0.1-1.0 ng/mL as determined by the dose dependent proliferation of NIH 3T3 cells.
• Molecular Mass: 17.3 kDa
• Protein length: 134-288, 154 amino acid
• AA Sequence: AAGSITTLPALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS
• Endotoxin: < 0.01 ng/μg cytokine as determined by the LAL assay
• Purity: > 98% by SDS-PAGE
• Usage: Useful for cell culture and for the study of signaling pathways.
• Storage: Storage use a manual defrost freezer and avoid repeated freeze-thaw cycles. It is stable for 12 months from date of receipt at -20 to -80 centigrade or two weeks at 2 to 8 centigrade under sterile conditions.
• Storage Buffer: Sterile filtered through a 0.22 micron filter with Tris buffer (10 mM Tris pH7.5, 150 mM NaCl).
• Shipping: The product is shipped on dry ice.

Gene Information

• Gene Name: FGF2 fibroblast growth factor 2 [ Homo sapiens (human) ]
• Official Symbol: FGF2
• Synonyms: FGF2; fibroblast growth factor 2; BFGF; FGFB; FGF-2; HBGF-2; fibroblast growth factor 2; basic fibroblast growth factor bFGF; fibroblast growth factor 2 (basic); heparin-binding growth factor 2; prostatropin
• Gene ID: 2247
• mRNA Refseq: NM_002006
• Protein Refseq: NP_001997
• MIM: 134920
• UniProt ID: P09038