Recombinant Human FIBP protein, His-SUMO-tagged

• Cat.No.: FIBP-2919H
• Product Overview: Recombinant Human FIBP protein(O43427)(2-357aa), fused to N-terminal His tag and SUMO tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: His&SUMO
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 57.1 kDa
• Protein length: 2-357aa
• AA Sequence: TSELDIFVGNTTLIDEDVYRLWLDGYSVTDAVALRVRSGILEQTGATAAVLQSDTMDHYRTFHMLERLLHAPPKLLHQLIFQIPPSRQALLIERYYAFDEAFVREVLGKKLSKGTKKDLDDISTKTGITLKSCRRQFDNFKRVFKVVEEMRGSLVDNIQQHFLLSDRLARDYAAIVFFANNRFETGKKKLQYLSFGDFAFCAELMIQNWTLGAVDSQMDDMDMDLDKEFLQDLKELKVLVADKDLLDLHKSLVCTALRGKLGVFSEMEANFKNLSRGLVNVAAKLTHNKDVRDLFVDLVEKFVEPCRSDHWPLSDVRFFLNQYSASVHSLDGFRHQALWDRYMGTLRGCLLRLYHD
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: FIBP fibroblast growth factor (acidic) intracellular binding protein [ Homo sapiens ]
• Official Symbol: FIBP
• Synonyms: FIBP; fibroblast growth factor (acidic) intracellular binding protein; acidic fibroblast growth factor intracellular-binding protein; FGFIBP; aFGF intracellular-binding protein; FGF-1 intracellular-binding protein; FIBP-1
• Gene ID: 9158
• mRNA Refseq: NM_004214
• Protein Refseq: NP_004205
• MIM: 608296
• UniProt ID: O43427