Recombinant Human FIBP protein, His-SUMO-tagged
Cat.No. : | FIBP-2919H |
Product Overview : | Recombinant Human FIBP protein(O43427)(2-357aa), fused to N-terminal His tag and SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Source : | E. coli |
Species : | Human |
Tag : | His&SUMO |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 57.1 kDa |
Protein length : | 2-357aa |
AA Sequence : | TSELDIFVGNTTLIDEDVYRLWLDGYSVTDAVALRVRSGILEQTGATAAVLQSDTMDHYRTFHMLERLLHAPPKLLHQLIFQIPPSRQALLIERYYAFDEAFVREVLGKKLSKGTKKDLDDISTKTGITLKSCRRQFDNFKRVFKVVEEMRGSLVDNIQQHFLLSDRLARDYAAIVFFANNRFETGKKKLQYLSFGDFAFCAELMIQNWTLGAVDSQMDDMDMDLDKEFLQDLKELKVLVADKDLLDLHKSLVCTALRGKLGVFSEMEANFKNLSRGLVNVAAKLTHNKDVRDLFVDLVEKFVEPCRSDHWPLSDVRFFLNQYSASVHSLDGFRHQALWDRYMGTLRGCLLRLYHD |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | FIBP fibroblast growth factor (acidic) intracellular binding protein [ Homo sapiens ] |
Official Symbol | FIBP |
Synonyms | FIBP; fibroblast growth factor (acidic) intracellular binding protein; acidic fibroblast growth factor intracellular-binding protein; FGFIBP; aFGF intracellular-binding protein; FGF-1 intracellular-binding protein; FIBP-1; |
Gene ID | 9158 |
mRNA Refseq | NM_004214 |
Protein Refseq | NP_004205 |
MIM | 608296 |
UniProt ID | O43427 |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All FIBP Products
Required fields are marked with *
My Review for All FIBP Products
Required fields are marked with *
0
Inquiry Basket