Recombinant Human FHL2 Protein, GST-tagged

• Cat.No.: FHL2-4162H
• Product Overview: Human FHL2 full-length ORF ( AAH14397, 1 a.a. - 279 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: LIM proteins contain a highly conserved double zinc finger motif called the LIM domain.[supplied by OMIM
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 56.43 kDa
• AA Sequence: MTERFDCHHCNESLFGKKYILREESPYCVVCFETLFANTCEECGKPIGCDCKDLSYKDRHWHEACFHCSQCRNSLVDKPFAAKEDQLLCTDCYSNEYSSKCQECKKTIMPGTRKMEYKGSSWHETCFICHRCQQPIGTKSFIPKDNQNFCVPCYEKQHAMQCVQCKKPITTGGVTYREQPWHKECFVCTACRKQLSGQRFTARDDFAYCLNCFCDLYAKKCAGCTNPISGLGGTKYISFEERQWHNDCFNCKKCSLSLVGRGFLTERDDILCPDCGKDI
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: FHL2 four and a half LIM domains 2 [ Homo sapiens ]
• Official Symbol: FHL2
• Synonyms: FHL2; four and a half LIM domains 2; four and a half LIM domains protein 2; DRAL; SLIM3; LIM domain protein DRAL; aging-associated gene 11; skeletal muscle LIM-protein 3; four and a half LIM-domain protein 2; down-regulated in rhabdomyosarcoma LIM protein; AAG11; FHL-2; SLIM-3
• Gene ID: 2274
• mRNA Refseq: NM_001039492
• Protein Refseq: NP_001034581
• MIM: 602633
• UniProt ID: Q14192