Recombinant Human FGG, His-tagged

• Cat.No.: FGG-103H
• Product Overview: Recombinant Human Fibrinogen γ Chain/FGG is produced in human cells. The target protein is expressed with sequence (Tyr27-Asp130) of Human FGG fused with a polyhistidine tag at the C-terminus.

Specification

• Description: The protein encoded by this gene is the gamma component of fibrinogen, a blood-borne glycoprotein comprised of three pairs of nonidentical polypeptide chains. Following vascular injury, fibrinogen is cleaved by thrombin to form fibrin which is the most abundant component of blood clots. In addition, various cleavage products of fibrinogen and fibrin regulate cell adhesion and spreading, display vasoconstrictor and chemotactic activities, and are mitogens for several cell types. Mutations in this gene lead to several disorders, including dysfibrinogenemia, hypofibrinogenemia and thrombophilia. Alternative splicing results in two transcript variants encoding different isoforms.
• Source: HEK293
• Species: Human
• Tag: His
• Form: Lyophilized from a 0.2 μM filtered solution of 20mM PB, 150mM NaCl, pH 7.4
• AA Sequence: YVATRDNCCILDERFGSYCPTTCGIADFLSTYQTKVDKDLQSLEDILHQVENKTSEVKQLIKAIQ LTYNPDESSKPNMIDAATLKSRKMLEEIMKYEASILTHDVDHHHHHH
• Endotoxin: Less than 0.1 ng/µg (1 IEU/µg).
• Purity: Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
• Storage: Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
• Reconstitution: Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
• Protein length: 27-130 a.a.

Gene Information

• Gene Name: FGG fibrinogen gamma chain [ Homo sapiens ]
• Official Symbol: FGG
• Synonyms: FGG; fibrinogen gamma chain; fibrinogen, gamma polypeptide
• Gene ID: 2266
• mRNA Refseq: NM_000509
• Protein Refseq: NP_000500
• MIM: 134850
• UniProt ID: P02679
• Chromosome Location: 4q28
• Pathway: Blood Clotting Cascade; Common Pathway; Complement and coagulation cascades
• Function: eukaryotic cell surface binding; protein binding, bridging; receptor binding