Recombinant Human FGF4 protein

Cat.No. : FGF4-167H
Product Overview : Recombinant Human FGF4 protein was expressed in Escherichia coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : Non
Protein Length : 182
Description : FGF-4, also named FGF­K and K­FGF, belongs to the fibroblast growth factor (FGF) family. By signaling through the FGF R1c, 2c, 3c and 4 receptors, FGF-4 has functions that maintain a population of progenitor cells in the epiblast that generates mesoderm, and contribute to the stem cell population that is incorporated in the tailbud. It is also required for axial elongation of the mouse embryo after gastrulation. Mature human FGF­4 (71­206 a.a.) shares 91 %, 82 %, 94 % and 91 % a.a. identity with murine, rat, canine and bovine FGF­4. Additionally, FGF-4 shares about 30 % sequence identity with the prototypical members of the FGF family.
Form : Lyophilized from a 0.2μm filtered concentrated solution in 1 × PBS, pH 7.4, 300 mM NaCl.
Bio-activity : Fully biologically active when compared to standard. The ED50 as determined by thymidine uptake assay using FGF-receptors transfected BaF3 cells is less than 0.5 ng/ml, corresponding to a specific activity of > 2.0 × 10⁶ IU/mg.
Molecular Mass : Approximately 19.8 kDa, a single non-glycosylated polypeptide chain containing 182 amino acids.
AA Sequence : GRGGAAAPTAPNGTLEAELERRWESLVALSLARLPVAAQPKEAAVQSGAGDYLLGIKRLRRLYCNVGIGFHLQALPDGRIGGAHADTRDSLLELSPVERGVVSIFGVASRFFVAMSSKGKLYGSPFFTDECTFKEILLPNNYNAYESYKYPGMFIALSKNGKTKKGNRVSPTMKVTHFLPRL
Endotoxin : Less than 1 EU/µg of rHuFGF-4 as determined by LAL method.
Purity : >96% by SDS-PAGE and HPLC analysis.
Storage : Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions.
Gene Name FGF4
Official Symbol FGF4
Synonyms FGF4; fibroblast growth factor 4; heparin secretory transforming protein 1 , HSTF1; HBGF 4; HST; HST 1; human stomach cancer; transforming factor from FGF related oncogene; K FGF; kaposi sarcoma oncogene; KFGF; transforming protein KS3; FGF-4; HSTF-1; oncogene HST; heparin-binding growth factor 4; heparin secretory transforming protein 1; heparin secretory-transforming protein 1; fibroblast growth factor 4 splice isoform; human stomach cancer, transforming factor from FGF-related oncogene; HST-1; HSTF1; K-FGF; HBGF-4;
Gene ID 2249
mRNA Refseq NM_002007
Protein Refseq NP_001998
MIM 164980
UniProt ID P08620

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All FGF4 Products

Required fields are marked with *

My Review for All FGF4 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon