Recombinant Human FGF23 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: FGF23-3431H
• Product Overview: FGF23 MS Standard C13 and N15-labeled recombinant protein (NP_065689) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: This gene encodes a member of the fibroblast growth factor family of proteins, which possess broad mitogenic and cell survival activities and are involved in a variety of biological processes. The product of this gene regulates phosphate homeostasis and transport in the kidney. The full-length, functional protein may be deactivated via cleavage into N-terminal and C-terminal chains. Mutation of this cleavage site causes autosomal dominant hypophosphatemic rickets (ADHR). Mutations in this gene are also associated with hyperphosphatemic familial tumoral calcinosis (HFTC).
• Molecular Mass: 28 kDa
• AA Sequence: MLGARLRLWVCALCSVCSMSVLRAYPNASPLLGSSWGGLIHLYTATARNSYHLQIHKNGHVDGAPHQTIYSALMIRSEDAGFVVITGVMSRRYLCMDFRGNIFGSHYFDPENCRFQHQTLENGYDVYHSPQYHFLVSLGRAKRAFLPGMNPPPYSQFLSRRNEIPLIHFNTPIPRRHTRSAEDDSERDPLNVLKPRARMTPAPASCSQELPSAEDNSPMASDPLGVVRGGRVNTHAGGTGPEGCRPFAKFITRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: FGF23 fibroblast growth factor 23 [ Homo sapiens (human) ]
• Official Symbol: FGF23
• Synonyms: FGF23; fibroblast growth factor 23; ADHR; FGFN; HYPF; HFTC2; HPDR2; PHPTC; fibroblast growth factor 23; phosphatonin; tumor-derived hypophosphatemia inducing factor
• Gene ID: 8074
• mRNA Refseq: NM_020638
• Protein Refseq: NP_065689
• MIM: 605380
• UniProt ID: Q9GZV9