Recombinant Human FGF19 protein

• Cat.No.: FGF19-238H
• Product Overview: Recombinant Human FGF19 protein was expressed in Escherichia coli.

Specification

• Species: Human
• Source: E.coli
• Tag: Non
• Protein Length: 195
• Description: Human FGF-19 is encoded by the FGF19 gene. FGF-19 belongs to the FGF-19 subfamily which has three members FGF-19, 21, 23. FGFs are classically considered to be paracrine factors and are known for their roles in tissue patterning and organogenesis during embryogenesis. By contrast, the FGF-19 subfamily has recently been shown to function in an endocrine manner. Members of this subfamily have poor ability of binding to heparin binding site which is a crucial factor in ligand-receptor complex formation. β-Klotho has been identified as co-factor required for FGF-19, 21, 23 signaling. It can obviously increase ligand-receptor affinity. Unlike most FGFs which bind to and activate more than one FGF receptor, FGF19 is a specific ligand for FGF R4. In FGF-19 transgenic mice, reducing liver triglycerides, increasing fatty acid oxidation, reducing glucose levels and improving insulin sensitivity can be observed.
• Form: Lyophilized from a 0.2μm filtered concentrated solution in PBS, pH 7.4.
• Bio-activity: Assay #1: Fully biologically active when compared to standard. The biological activity is measured by its binding ability in a functional ELISA. Immobilized rHuFGF R4 at 5 µg/ml can bind rHuFGF-19 with a linear range of 3-200 ng/ml.Assay #2: Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using murine Balb/c 3T3 cells is less than 150 ng/ml, corresponding to a specific activity of > 6.7 × 10³ IU/mg.
• Molecular Mass: Approximately 21.8 kDa, a single non-glycosylated polypeptide chain containing 195 amino acids.
• AA Sequence: MRPLAFSDAGPHVHYGWGDPIRLRHLYTSGPHGLSSCFLRIRADGVVDCARGQSAHSLLEIKAVALRTVAIKGVHSVRYLCMGADGKMQGLLQYSEEDCAFEEEIRPDGYNVYRSEKHRLPVSLSSAKQRQLYKNRGFLPLSHFLPMLPMVPEEPEDLRGHLESDMFSSPLETDSMDPFGLVTGLEAVRSPSFEK
• Endotoxin: Less than 1 EU/µg of rHuFGF-19 as determined by LAL method.
• Purity: >95% by SDS-PAGE and HPLC analysis.
• Storage: Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions.

Gene Information

• Gene Name: FGF19
• Official Symbol: FGF19
• Synonyms: FGF19; fibroblast growth factor 19; FGF-19
• Gene ID: 9965
• mRNA Refseq: NM_005117
• Protein Refseq: NP_005108
• MIM: 603891
• UniProt ID: O95750