Recombinant Full Length Human FGF19 Protein, C-Flag-tagged
Cat.No. : | FGF19-857HFL |
Product Overview : | Recombinant Full Length Human FGF19 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes including embryonic development cell growth, morphogenesis, tissue repair, tumor growth and invasion. This growth factor is a high affinity, heparin dependent ligand for FGFR4. Expression of this gene was detected only in fetal but not adult brain tissue. Synergistic interaction of the chick homolog and Wnt-8c has been shown to be required for initiation of inner ear development. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 21.6 kDa |
AA Sequence : | MRSGCVVVHVWILAGLWLAVAGRPLAFSDAGPHVHYGWGDPIRLRHLYTSGPHGLSSCFLRIRADGVVDC ARGQSAHSLLEIKAVALRTVAIKGVHSVRYLCMGADGKMQGLLQYSEEDCAFEEEIRPDGYNVYRSEKHR LPVSLSSAKQRQLYKNRGFLPLSHFLPMLPMVPEEPEDLRGHLESDMFSSPLETDSMDPFGLVTGLEAVR SPSFEKTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Adult stem cells, Druggable Genome, Embryonic stem cells, ES Cell Differentiation/IPS, Secreted Protein, Transmembrane |
Protein Pathways : | MAPK signaling pathway, Melanoma, Pathways in cancer, Regulation of actin cytoskeleton |
Full Length : | Full L. |
Gene Name | FGF19 fibroblast growth factor 19 [ Homo sapiens (human) ] |
Official Symbol | FGF19 |
Synonyms | fibroblast growth factor 19 |
Gene ID | 9965 |
mRNA Refseq | NM_005117.3 |
Protein Refseq | NP_005108.1 |
MIM | 603891 |
UniProt ID | O95750 |
◆ Recombinant Proteins | ||
FGF19-28824TH | Recombinant Human FGF19 Protein, Fc-tagged | +Inquiry |
FGF19-1484H | Recombinant Human FGF19 Protein, His-tagged | +Inquiry |
FGF19-3331H | Recombinant Human FGF19 Protein (Phe27-Lys216), N-His tagged | +Inquiry |
FGF19-01H | Recombinant Human FGF-19 Protein, His-Tagged | +Inquiry |
FGF19-75H | Recombinant Active Human FGF19 Protein, His-tagged(C-ter) | +Inquiry |
◆ Cell & Tissue Lysates | ||
FGF19-6244HCL | Recombinant Human FGF19 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FGF19 Products
Required fields are marked with *
My Review for All FGF19 Products
Required fields are marked with *
0
Inquiry Basket