Recombinant Human FGF14 Protein, GST-tagged

• Cat.No.: FGF14-4104H
• Product Overview: Human FGF14 partial ORF ( NP_004106, 138 a.a. - 247 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. A mutation in this gene is associated with autosomal dominant cerebral ataxia. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq
• Molecular Mass: 37.84 kDa
• AA Sequence: LFTPECKFKESVFENYYVIYSSMLYRQQESGRAWFLGLNKEGQAMKGNRVKKTKPAAHFLPKPLEVAMYREPSLHDVGETVPKPGVTPSKSTSASAIMNGGKPVNKSKTT
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: FGF14 fibroblast growth factor 14 [ Homo sapiens ]
• Official Symbol: FGF14
• Synonyms: FGF14; fibroblast growth factor 14; FHF4; SCA27; bA397O8.2; fibroblast growth factor homologous factor 4; FHF-4; FGF-14; MGC119129
• Gene ID: 2259
• mRNA Refseq: NM_004115
• Protein Refseq: NP_004106
• MIM: 601515
• UniProt ID: Q92915