Recombinant Human FGF11 Protein, GST-tagged

• Cat.No.: FGF11-4101H
• Product Overview: Human FGF11 partial ORF ( NP_004103, 15 a.a. - 103 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. The function of this gene has not yet been determined. The expression pattern of the mouse homolog implies a role in nervous system development. [provided by RefSeq
• Molecular Mass: 35.53 kDa
• AA Sequence: VREPGGSRPVSAQRRVCPRGTKSLCQKQLLILLSKVRLCGGRPARPDRGPEPQLKGIVTKLFCRQGFYLQANPDGSIQGTPEDTSSFTH
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: FGF11 fibroblast growth factor 11 [ Homo sapiens ]
• Official Symbol: FGF11
• Synonyms: FGF11; fibroblast growth factor 11; FHF3; fibroblast growth factor homologous factor 3; FLJ16061; MGC45269; MGC102953; FHF-3; FGF-11
• Gene ID: 2256
• mRNA Refseq: NM_004112
• Protein Refseq: NP_004103
• MIM: 601514
• UniProt ID: Q92914