Active Recombinant Human FGF1 Protein (Carry Free-Lyophilized, 140 amino acid)

• Cat.No.: FGF1-12H
• Product Overview: Recombinant Human FGF1 Protein (Carry Free-Lyophilized) without tag was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Protein Length: 140 amino acid
• Description: The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. This protein functions as a modifier of endothelial cell migration and proliferation, as well as an angiogenic factor. It acts as a mitogen for a variety of mesoderm- and neuroectoderm-derived cells in vitro, thus is thought to be involved in organogenesis. Multiple alternatively spliced variants encoding different isoforms have been described.
• Form: Lyophilized
• Bio-activity: ED50 < 0.1 ng/mL as determined by its ability to the dose dependent proliferation of mouse Balb/c 3T3 cells.
• Molecular Mass: 15.8 kDa
• AA Sequence: FNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD
• Endotoxin: < 1.0 EU/μg of protein as determined by the LAL assay
• Purity: > 98% by SDS-PAGE
• Storage: It is stable for up to 6 months from date of receipt when stored at -20 centigrade. Multiple freeze/thaw cycles should be avoided as it can result in significant loss of activity.
• Storage Buffer: Sterile filtered through a 0.2 micron filter. Lyophilized with no additives.
• Reconstitution: Centrifuge the vial before opening. Reconstitute in sterile water to aconcentration of 0.1 -1.0 mg/mL. Do not vortex. For extended storage, it isrecommended to further dilute in a buffer containing a carrier protein (example 0.1% BSA) and store in working aliquots at -20 to -80 centigrade.
• Shipping: This product is shipped at 4 centigrade with cold pack.

Gene Information

• Gene Name: FGF1 fibroblast growth factor 1 [ Homo sapiens (human) ]
• Official Symbol: FGF1
• Synonyms: FGF1; fibroblast growth factor 1; AFGF; ECGF; FGFA; ECGFA; ECGFB; FGF-1; HBGF1; HBGF-1; GLIO703; ECGF-beta; FGF-alpha; fibroblast growth factor 1; beta-endothelial cell growth factor; endothelial cell growth factor, alpha; endothelial cell growth factor, beta; fibroblast growth factor 1 (acidic); heparin-binding growth factor 1
• Gene ID: 2246
• mRNA Refseq: NM_000800
• Protein Refseq: NP_000791
• MIM: 131220
• UniProt ID: P05230