Recombinant Human FGF1 protein, His-tagged

• Cat.No.: FGF1-2903H
• Product Overview: Recombinant Human FGF1 protein(P05230)(16-155aa), fused to C-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 16-155aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 17.8 kDa
• AA Sequence: FNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: FGF1 fibroblast growth factor 1 (acidic) [ Homo sapiens ]
• Official Symbol: FGF1
• Synonyms: FGF1; fibroblast growth factor 1 (acidic); FGFA; fibroblast growth factor 1; AFGF; ECGF; ECGF beta; ECGFA; ECGFB; endothelial cell growth factor; alpha; beta; FGF alpha; GLIO703; HBGF1; heparin binding growth factor 1; heparin-binding growth factor 1; beta-endothelial cell growth factor; endothelial cell growth factor, beta; endothelial cell growth factor, alpha; FGF-1; HBGF-1; ECGF-beta; FGF-alpha
• Gene ID: 2246
• mRNA Refseq: NM_000800
• Protein Refseq: NP_000791
• MIM: 131220
• UniProt ID: P05230